KEGG   Bacillus thuringiensis Bt407: BTB_c22690Help
Entry
BTB_c22690        CDS       T02277                                 

Gene name
dfrD
Definition
dihydrofolate reductase DfrD (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTB_c22690 (dfrD)
   00670 One carbon pool by folate
    BTB_c22690 (dfrD)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BTB_c22690 (dfrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2179537..2180025
Genome map
AA seq 162 aa AA seqDB search
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRN
IIVTRNEGYHVEGCEVVHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHYA
FEGDTFFPEMDMTNWKEIFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttcatttatggtcgcaatggacgaaaatagagtaattggtaaagataataat
ttaccttggcgtttaccgagtgaattacaatacgtgaagaaaacaacgatgggtcacccg
cttattatgggaagaaagaactatgaagcgattggtagaccgctgcctggaagacgtaat
attattgtaacacgtaatgaaggatatcacgttgaaggatgtgaagttgttcattctgta
gaagaagtattcgaactatgtaaaaatgaagaagagatttttatttttggcggagcgcaa
atttacgatctctttttaccatacgtagacaagttgtatataacaaaaattcattatgca
tttgaaggagatacattcttcccagaaatggatatgacaaattggaaagagatttttgta
gaaaaaggtttaacagatgaaaaaaacccgtatacgtattattaccacgtatatgagaaa
caacaataa

DBGET integrated database retrieval system