KEGG   Bacillus thuringiensis Bt407: BTB_c22960Help
Entry
BTB_c22960        CDS       T02277                                 

Gene name
adh2
Definition
alcohol dehydrogenase Adh (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTB_c22960 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTB_c22960 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    BTB_c22960 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTB_c22960 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTB_c22960 (adh2)
   00626 Naphthalene degradation
    BTB_c22960 (adh2)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTB_c22960 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2204796..2205833
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLRSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVNSLKIGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIVQEELGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKKHNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcaaacatcgaagtgattgaaaaagaa
ttacgtccgttacgctcaggcgaagcgttagtagatgtagagtattgtggagtttgccac
actgatttacacgttgcgaatcatgattttggtaacactgatggccgtattcttggtcat
gagggtgtaggtattgttacgaaaatagctgatgatgttaattcgctaaagataggtgac
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtaactggt
agagaaacattttgccgtgaagttaaaaacgcaggttattcagtagatggtggtatggct
gaacaatgtatcgttacagctgattatgcggtaaaagtaccagaaggattagatcctgct
caagcatcatcaattacatgtgctggtgtaactacatataaagctattaaagtatcagat
attaaacctggtcaacctattgtaatctatggctgcggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaatcgcagtagacattaatgacgacaaa
ttagccttagcgaaagaagttggtgctgatatgactatcaatccaatatctcaaggtcct
gctgataaaattgttcaagaggagcttggtggcgcttatgctgcggtagtaacagcagtc
tctaaagtagcctttaactcagcagttgatgcagtacgtgcttgcggtaaagtagttgca
gtagggctaccagtagaaacaatggacttaaacatcccgcgacttgtactggatggaatt
gaagtagttggttctctagtgggtactcgtaaagatttggaagaggcgtttatgtttggg
gcagaaggaaaagtagtgccggttgttcaaacttgttcgctagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaattgattttaaaaaacat
aattgtgattgcaaataa

DBGET integrated database retrieval system