KEGG   Bacillus thuringiensis Bt407: BTB_c25920Help
Entry
BTB_c25920        CDS       T02277                                 

Gene name
acsA1
Definition
(GenBank) acetyl-coenzyme A synthetase AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00010  Glycolysis / Gluconeogenesis
btg00620  Pyruvate metabolism
btg00640  Propanoate metabolism
btg00680  Methane metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01130  Biosynthesis of antibiotics
btg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTB_c25920 (acsA1)
   00620 Pyruvate metabolism
    BTB_c25920 (acsA1)
   00640 Propanoate metabolism
    BTB_c25920 (acsA1)
  Energy metabolism
   00680 Methane metabolism
    BTB_c25920 (acsA1)
Enzymes [BR:btg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BTB_c25920 (acsA1)
Lipid biosynthesis proteins [BR:btg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BTB_c25920 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFV18280
Position
2528297..2530237
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLENGTPFAQWYNGGTCNVVESALSRWLADEETRIQPALQYEGENGTSKSFTYEEL
DNWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFIHAEEMQSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKGNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGKPIQDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVIYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDEVKGEVCHCFVVLRDHVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtacaaggaaaaaacacgtttatatggt
tggatgaaatcattgggatatgaagattatgaaactttttataataaatctattgaggaa
acagcttggttttggggagaggcagaaaaagcagttggctatcaatggatgaaaccttat
acagaagtattagatttagaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagctttatcccgctggcttgcggatgaagagacgagaatacag
ccagcacttcagtacgaaggggaaaatggaacttcaaaatcatttacatatgaagagctt
gacaactgggtaagccgtgttgcaaatggtttgaaacacgcgggtattgagaaaggtgac
cgtgtaacaatttatatgccgatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggctttgcgtctgatgcagttatgaca
cgtgtgcaagcggcaggttcaaaaatgattattaccgcagatggattttcacgccgcggt
aaaattgtttctttaaaagatgaagtagataaagcttgtgaacattgcccaactgttgaa
aaagttgttatcgttcgtcatgcaggaaatgattttacaccacataactatgacttttcg
tggagtacgctagaaaaagaaaaaccattcatacatgccgaggaaatgcaaagtgatgat
ccattaatgctcatttatacatcaggaacgactggtaagccgaaaggaacagtacacacg
catgcaggatttcctttgaaagcagcttttgatgcaggatttggaatgaatattaaacaa
ggtgatcgtgtattatgggtaactgatatgggctggatgatggggccgtttctattattc
ggttcactcattaatggagcaacgatggttatgtacgaaggtgttccagacttcccagaa
gcagaccggttatgggagacagttgataaatatgaaattactcatctaggtatttcgcca
acgttaatccgagcattaatggcaaaaggtgatgagtatgtcaataaacattctttaaag
agtttggaagtattcgcatcaacaggagaaccttggaatcctgatccatggatgtggctg
tttgaaacagttggaaaaggaaatgttccaatctgtaactactcaggtggaactgaaatc
tctggtgggattttcggtaatgttcttattaagccaatcgcaccgattagttttaacgca
tctttaccaggaatggcagctgtcgtgctggatgatcaaggtaaaccaattcaagatgaa
gtcggagaattatgcttagagaaaccttgggtaggtatgacgaaaagcttctgggaagat
gatgaacgttacgtgaacacatattggtcgcgttttgaaaataaatgggtccacggtgac
tgggtcatttacgatggtgaacaatatatcatcacagggcgttcagacgatacgttaaat
attgcaggtaaacgtattggacctgctgaatatgaatctattcttgtgaaacataatgat
gtaatcgaagctgctgcaattggtgtacctgacgaagtaaaaggtgaagtttgtcattgt
tttgtagtgttaagagatcatgtaacattcacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcgttgtgtcctaaagacatccacgttgtagaagat
ttaccgaaaacacgtaattctaaagtaatgcgccgtgttattaaagcagcttatttagga
aaagaattaggtgatttgtcgtcacttgtaaatcctgaagtagtaccgtttattcaaggg
ttacagtctagtaaattataa

DBGET integrated database retrieval system