KEGG   Bacillus thuringiensis Bt407: BTB_c31030Help
Entry
BTB_c31030        CDS       T02277                                 

Gene name
proB
Definition
glutamate 5-kinase ProB (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTB_c31030 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BTB_c31030 (proB)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BTB_c31030 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2997947..2999050)
Genome map
AA seq 367 aa AA seqDB search
MKKQRIVVKIGSSSLADSHVGISTEQLSDHVAALARLKADGHEVVLITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATL
GELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQK
NADAKKYYFLPEVTEEISSLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEK
FVDVLKGKGDGTYVGNAPQKEMKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKSLLPAG
VTNVSGFFQVGEVVEVVTQQGRVIGKGQCAYSAEELRDVKGMQSQDIQVRGERHSYEVIH
RDHWVSL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacaacgaattgttgtaaagattggaagtagttccttggcagatagtcatgta
ggcatctctacagaacagctttcagatcacgttgccgcattggctcggttgaaagctgat
gggcacgaggttgtgttaattacatctggagccgttgctgcagggttttcagcgctagga
tatcctagcagacctgtaacgattaaagggaaacaggctgcagcagctgtcggacaaagt
ttgttaatgcaggcgtacacggaggaattccgtaaatatggcatcgttactgcgcaactt
ttgttgacgagaagtgatttttctagaaaagaacagtatagtaatgcttacgctacgtta
ggagaattattaaaccgttccgctcttccaattattaatgaaaatgattccatctcttta
gaggagctgacgttcggtgataatgatatgctgtcagctttagtaagcgggcttgtttcg
gcggatatgcttatgatctttacagatgtgaacgggttatatgacaaaaatcctcagaaa
aatgcggatgcaaaaaaatattattttcttcctgaagttacggaagaaatttcttctctt
gcaggagatgctggctcaaaacttgggactggcggtatgaaatcaaaaatcgatgctgca
aagacagcactctctcttggtgtgagtgtatttatcggaacaggacgtgggcaggaaaag
tttgtagatgttttgaagggtaagggtgacggaacgtatgtcggtaatgctcctcaaaaa
gaaatgaagatgaacaagcaatggattgccttgcattcgcttgttagcggacaaattgaa
gtagatgctggggcagctactgccatcattcagcatggtaagagtttacttccagctggt
gttacgaatgtatcaggatttttccaagtgggtgaagttgtagaggttgtaacgcaacaa
gggcgcgtaataggaaaaggacaatgcgcatatagtgcagaggaactaagagatgtaaaa
ggtatgcaaagccaagatattcaagtaagaggcgagagacatagttatgaagtcatccat
agggatcattgggtttcactttaa

DBGET integrated database retrieval system