KEGG   Bacillus thuringiensis Bt407: BTB_c33040Help
Entry
BTB_c33040        CDS       T02277                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase DcyD (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:btg00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3203347..3204342)
Genome map
AA seq 331 aa AA seqDB search
MNLAKFPRKKYTESYTPIEKLNNFSEALGGPTIYFKRDDLLGLTAGGNKTRKLEFLVADA
QEKGADTLITAGGIQSNHCRLTLAAAVKEKMKCILVLEEGLEPEEKRDFNGNYFLYHLLG
AENVIVVPNGADLMEEMNKVAKEVSEKGSTPYVIPVGGSNPTGAMGYVACAQEIMAQSFE
QGIDFSSVVCVSGSGGMHAGLITGFSGTQSHIPVIGINVSRGKAEQEEKVAKLVDETSAH
VGIPNFISRDAVTCFDEYVGPGYALPTPEMVEAVQLLAKTEGILLDPVYTGKAVAGLIDL
IRKGKFNKEDNILFVHSGGSPALYANTSLFA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagctaaattcccgagaaaaaaatatacagaatcatatacaccaattgaaaag
ttaaacaatttttctgaagcacttggtggcccgactatttattttaaacgagatgattta
cttggtttaacagccggtggtaataagacgagaaagttagaatttttagttgcggatgca
caggaaaagggtgcagatacgttaattacagctggtggtattcagtcaaatcattgccgc
ctgacacttgctgctgcggtaaaagaaaaaatgaaatgtattcttgtattagaggaaggg
cttgagccagaagagaagagagactttaacggaaactatttcttatatcacttattaggt
gctgaaaacgtcattgttgtaccgaacggagcagacctgatggaagagatgaataaagta
gcgaaagaagtaagtgaaaaaggtagtacaccatatgtaattccagttggtggatcaaac
cctacgggcgcaatgggatacgttgcttgtgcgcaagaaattatggcgcaatcatttgag
caaggaattgatttcagttcagttgtttgtgtaagtggtagcggcggtatgcatgctggt
ttaattactggtttttctggaacacaaagccatattcctgtaatcgggattaatgtaagt
agaggaaaagctgagcaagaagagaaagtagcaaaacttgtagatgaaacttcagcacac
gttggtattccaaactttatctcgcgcgacgctgttacgtgctttgatgaatatgtagga
ccaggctatgcgttaccaacgccggaaatggtagaggcagttcagttacttgcgaaaaca
gaaggtattttacttgatccagtgtatacaggtaaggcagtagcgggattaatcgactta
attagaaaaggtaaatttaataaggaagacaatattttattcgtacattcaggtggttca
ccagctttatatgcgaatacttctttatttgcgtaa

DBGET integrated database retrieval system