KEGG   Bacillus thuringiensis Bt407: BTB_c34050Help
Entry
BTB_c34050        CDS       T02277                                 

Gene name
dxr1
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase 1 (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTB_c34050 (dxr1)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BTB_c34050 (dxr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3298134..3299291
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATK
DLADKLRTRISANTKITHGTDGLIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAQQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRD
KTREEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKIDVMIHK
ESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGTTPAVLNAANEIANALYLKNEIAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYANELLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatcaattttaggttcaacaggatccatcggcacatctgcattagat
gtcgtttcagctcatcctgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gatcttcttgagcaacaaatcaaaacgtttcaacctcgtattgtaagcgttgcgacaaaa
gacttagcagacaagcttcgtacgcgtatttcagcaaatacaaaaatcacacacgggact
gatggcttaattgcagtagctactcaccctgattcaaatcttgtattaagctctgttgta
ggtgtttcaggattactcccaacaattgaggcattaaaagcgaagaaagatatcgctatt
gctaataaagaaactttggttgcagctggacatatcgtaactgaactagcgcaacaaaac
ggatgtcgcttaattccagtagatagtgagcattcagctattttccaatgtttaaacggc
gaaaataataaagagattgagaagttaattgtaacagcttccggtggtgcttttcgtgat
aaaacacgtgaagaaatgcaaacattacaagctaaggacgctttaaaacatccaaactgg
ttaatgggtgcaaaactaacgattgattctgccacattaatgaataaaggctttgaagta
atggaagcgagatggctatttgatattccgtatgaaaaaattgatgtaatgattcataaa
gaaagtatcattcattctttagtagaatttattgatggatcagttatggcacagctcggt
gctcctgatatgagaatgccgattcaatatgcgtttcactatcctactcggctaccttct
tcctatgaaaaattaaatttattagaaatcggtagtttacattttgaaaaaccagattta
gagaagttcccttgtctacaatacgcatatgaatgtggcaaaatcggtggtactactccc
gctgtattaaatgcagcaaatgaaattgcgaatgcactatacttaaaaaatgaaattgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagctcatcataatgtaaaagat
ccttcacttgatgctatattggaagcggatcaatgggcgcgccaatatgcaaatgaattg
ttaataaaaaagagctaa

DBGET integrated database retrieval system