KEGG   Bacillus thuringiensis Bt407: BTB_c38330Help
Entry
BTB_c38330        CDS       T02277                                 

Gene name
bglC
Definition
aryl-phospho-beta-D-glucosidase BglC (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:btg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3732699..3734108)
Genome map
AA seq 469 aa AA seqDB search
MKFPHDFLFGAASASYQVEGAWNEDGKGVTNWDEFSKIPGKTYNGTNGDVAVDHYHRYKE
DVRLMAEMGLESYRFSISWARILPTGDGKVNEKGIEFYNNLIDECLKYGIVPFVTLYHWD
LPLPLEKDGGWTNKRTAEAFVKYAETCFKAFGDRVKHWITFNETVMFCGLGYLKGAHPPG
IQNDVPKYFQATHYVFYAHAKTVAVYKQLKQYGEIGITHVFLPAYSVDDQKENIRAANHA
NEYETYWYYDPILKGEYPSYVVQQLKEKGWTPNWTVEELEIIKQNAEENDFIGLNYYQPI
RVERYDMDIKSEEHSRENSTLAPGNPSFDGFYRTVKMDDKTYTKWGWEISPEGFLEGLHM
LKARYGDIKMYVTENGLGDEDPIIDGEIVDVPRIKFIEAHLKVMKRAIEEGINLKGYYAW
SVIDLLSWLNGYKKQYGFIFVDHNDNLKRKKKLSFHWYKRVIETRGEEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccacatgattttttattcggagctgcttcagcttcttatcaagtagaaggt
gcatggaatgaagatggaaaaggtgttacgaattgggacgagttttcaaaaattcctggc
aaaacatacaatggaacaaatggtgatgtagctgttgatcattatcatcgatataaggaa
gatgttcgcttaatggctgagatgggattagaatcgtatcgtttttctatttcttgggcg
agaatattgccgactggagatggaaaggtaaatgaaaaagggattgaattttataacaac
ttaattgatgaatgcttaaaatacgggattgtgccgtttgtcactttatatcattgggat
ttaccattaccgttagaaaaagatggtggatggacgaataaaagaacagcagaggctttc
gtaaaatatgcagaaacttgttttaaggcatttggtgacagagttaagcattggattact
tttaatgagacagtaatgttttgtggattaggttatttaaaaggtgcacatccaccagga
atccaaaatgatgttccaaagtattttcaagcgactcattatgtattttatgcacatgcg
aaaacagttgcggtgtacaagcagctgaaacaatatggtgagattgggattacacatgtt
ttcttacctgcttatagtgtggatgatcaaaaagaaaatatacgagcagcaaatcatgcg
aatgaatatgaaacgtattggtattatgatccaattttaaaaggcgagtatccgtcttat
gttgtacaacaattaaaggaaaaaggatggactcctaattggacggttgaagaattagaa
atcattaaacaaaatgcagaagaaaatgattttattggcttgaattattatcaaccaata
cgagtagaaagatacgatatggatataaagagtgaggaacattctcgagaaaactcaacg
cttgctccaggtaacccttcttttgatggtttttatcgaacagttaaaatggatgataaa
acatatacaaaatggggatgggaaatatctcccgaaggtttcttagagggattgcatatg
ttgaaagcgcgttacggtgacataaagatgtatgtaacggaaaatggacttggtgatgaa
gatccaatcattgacggagaaattgtagatgttccgagaattaaatttattgaagcgcat
ttaaaagtaatgaagcgtgcaattgaagagggaattaacttaaaaggttattatgcatgg
tcagtgattgatcttttaagttggttaaatggatataaaaagcaatatggctttattttt
gtcgatcataatgataacttaaaacgtaagaagaaactttcgtttcattggtataaacgt
gtgatcgaaacgagaggggaagagttataa

DBGET integrated database retrieval system