KEGG   Bacillus thuringiensis Bt407: BTB_c41650Help
Entry
BTB_c41650        CDS       T02277                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:btg00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:btg00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4061476..4062252
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGSAFAKEGAKVVITDRLEQRAKEAAEQLQSEGFQAIGLKC
DVTSEEEITASISQTVSHFGSLDILINNAGMQHVSPIEDFPTEKFELLIQIMQIAPFIAI
KHAFPIMKQQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtctttttaacaggtgctgcgagtggtattggatatgaaatg
ggaagtgcttttgcaaaagaaggtgcaaaagttgtgattactgatcgtcttgaacaacgt
gcgaaagaagctgctgagcaattacaaagtgaaggttttcaagctatcggtttaaaatgt
gacgttacatctgaagaggaaattacagcatcaatttctcaaacagttagtcatttcggt
tcattagatatattaattaacaacgcaggaatgcaacacgtttcacccattgaagacttt
ccaacggaaaagtttgagctactaattcaaattatgcaaattgctccgtttatcgcaatt
aagcatgcctttccgattatgaaacaacaaaaatatggtcgtattattaatgtcgcttct
attaacggccttgtcgggtttgctggaaaagctgcctacaatagtgcaaaacatggcgta
attggattaacaaaagttgccgctttagaaggtgctacgcatggtattactgttaatgcc
ctttgccctggttatgtcgatacccctcttgtacgtaatcaactacaagacttagctact
acacgaaatgtaccacttgaaaatgttttagaagatgttatttatccactcgtcccacaa
aagcgcttattacaagtacaagaaatcgctgattatgctatgtttttagcgagtgaaaaa
gctaaaggtattactggtcaagctgtcgttatcgatggtggctatactgcgcaataa

DBGET integrated database retrieval system