KEGG   Bacillus thuringiensis Bt407: BTB_c41740Help
Entry
BTB_c41740        CDS       T02277                                 

Gene name
mtnD
Definition
(GenBank) acireductone dioxygenase MtnD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00270  Cysteine and methionine metabolism
btg01100  Metabolic pathways
Module
btg_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTB_c41740 (mtnD)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BTB_c41740 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BTB_c41740 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding Cupin_3 DUF3047
Motif
Other DBs
NCBI-ProteinID: AFV19856
Position
4069859..4070371
Genome map
AA seq 170 aa AA seqDB search
MAQIHIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcatattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattctttaacagatgaaaacaaagctgaaatattagctgttttt
tcaaaagaaatcgctgatgtttcagcacgtcgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaattattaattaatttccaaaaagaacatcat
catacagacgacgaagtccgctttatcgtcagtggtcatggcattttcgctattgaaggc
aaagatgggaaattctttgatgttgaacttgagccaggcgatctaatatctgttccagaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gtaacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system