KEGG   Bacillus thuringiensis Bt407: BTB_c44030Help
Entry
BTB_c44030        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_28 Methyltransf_23 Methyltransf_25 Ubie_methyltran Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AFV20085
Position
complement(4266643..4267755)
Genome map
AA seq 370 aa AA seqDB search
MGMELILREWMGKEKDYSISYSTYMNLVLYTEGHGYYMKEREKIGRQGDFFTSSNVSSVF
AKTFAKLFIRLVENGEVASNICEVGGGTGKFAYDVLQEWKQLSPKTFIDLNYSMIEVSPF
HRKLQQEHLGSFSNVSYYTSYSEMGDSFEGILFSNELFDAFPVEIIEKRNGMLYEVRITY
TEEGSLSEICRPLDKRIGRYLLKYNIHIAEGQRFEVPLVMEEYVKEIAKWFQKGICITVD
YGYTKEEWMHPAHREGSLRGYYQHKLIRNPLAHPGEMDLTTHIHWDELKEMFSLQGMSAV
WHKKQSEFLLAAGILEQLTSHQDMNPFSETQKQNRAVRSMILNGGVGSAFDVVIHTKDMQ
HLHLERYVTI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggagctcattttaagagaatggatggggaaagaaaaggattattcaatttca
tatagtacgtatatgaaccttgtattgtatacagaaggtcatggatattatatgaaagaa
cgtgaaaagattggaagacaaggggatttttttacaagtagcaatgtatcctctgttttt
gcaaaaacttttgctaaactttttattcgtcttgttgaaaatggtgaagttgcttcgaat
atttgtgaggttggtgggggaactggaaagtttgcctatgatgttttacaagaatggaag
caattatctccaaaaacctttattgatttaaactattcaatgattgaagtgagccctttt
cataggaaattacagcaggagcaccttggctcattttctaatgtatcgtactatacctct
tatagtgaaatgggagattctttcgagggaattcttttttcgaatgagttgtttgatgca
tttcctgttgaaataattgagaaaagaaatggtatgttgtatgaagtgcgtattacatat
acagaggaaggaagcctttcagaaatatgtaggccgttagataaaagaattggtcgatat
ttattgaaatataatattcatattgctgaagggcaacgttttgaagtaccacttgtgatg
gaggagtatgtaaaagaaattgcgaaatggtttcaaaaaggtatatgtattacagttgat
tacggatacacaaaagaagaatggatgcatccagcacaccgtgaaggaagtttgcgaggt
tattatcagcataagctaatacgtaacccactagcgcatccaggtgaaatggatcttact
actcatattcattgggacgagctaaaggagatgtttagtctgcaaggaatgagtgcggta
tggcataagaaacaatctgagttcttgttagctgcggggatattagaacagcttacgagc
catcaagatatgaatcctttttctgaaacacaaaaacaaaatcgagcagttcgttctatg
attttgaatggaggagtagggagtgcgtttgatgttgttatacatacaaaagatatgcaa
catttacatttggagcggtatgtaacaatataa

DBGET integrated database retrieval system