KEGG   Bacillus thuringiensis Bt407: BTB_c44060Help
Entry
BTB_c44060        CDS       T02277                                 

Gene name
glcK
Definition
glucokinase GlcK (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTB_c44060 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTB_c44060 (glcK)
   00052 Galactose metabolism
    BTB_c44060 (glcK)
   00500 Starch and sucrose metabolism
    BTB_c44060 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BTB_c44060 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BTB_c44060 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BTB_c44060 (glcK)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BTB_c44060 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4268819..4269802)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTGEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETNKESMLRSMLAEEGRITSKDVFEALGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacaaatacaggtgagcaa
ggaaaacatattacacttgatgttgcgaaagcaattgataaaaagctagaagaattaggc
gaattgaagagcaagttaattggtattggtatgggagctcctggccctgtacatgtggca
tctggaatgatttatgaagcggttaatttagggtggaaaaactatccgctaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggtgcaaaagatttaatctgcatgacacttggt
acgggcgttggtggtggtgtaatcgccaatggtgagattgtacacggcgtgagtggtgct
gctggtgagattggacatattacagtagttacagaaaatgctttcccatgtaattgcggg
aagtctggttgcttagaaacagtagcatctgcgacaggtattgtacgtgttgctatgcaa
aaaatacaagagactaataaagaaagcatgttgcgttctatgttagctgaagaaggacgt
attacatcaaaagatgtctttgaagcacttggacaaggtgatgaattagcaggcgaagta
gtagaaaaggtagcttcttatttagggttagctgtagcgaacctatctagtacgttgaac
ccagagaaaattgttattggtggaggcgtgtctaaagctggagatgcgctattagaacca
attcaacgctatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system