KEGG   Bacillus thuringiensis Bt407: BTB_c44070Help
Entry
BTB_c44070        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF910 Tup_N DUF1843
Motif
Other DBs
NCBI-ProteinID: AFV20089
Position
complement(4269822..4270022)
Genome map
AA seq 66 aa AA seqDB search
MVSIYDIQQLLKKFGTIIYTGDRIADLQLMQDELRELNQSQLIDPQDYQTALFLLKQEIQ
KELNKN
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atggtatctatttatgatattcagcaattgctaaagaaatttggtacgattatttatacg
ggagatcgaattgcagatttacaattaatgcaagatgaattgcgtgaattaaatcaatca
cagctaatcgatccacaagactatcaaacagctttatttttattgaagcaagaaattcaa
aaagagctaaataagaattag

DBGET integrated database retrieval system