KEGG   Bacillus thuringiensis Bt407: BTB_c44100Help
Entry
BTB_c44100        CDS       T02277                                 

Gene name
glmU2
Definition
(GenBank) bifunctional protein GlmU
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00051  Fructose and mannose metabolism
btg00520  Amino sugar and nucleotide sugar metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTB_c44100 (glmU2)
   00520 Amino sugar and nucleotide sugar metabolism
    BTB_c44100 (glmU2)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BTB_c44100 (glmU2)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     BTB_c44100 (glmU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep PGM_PMM_I YbaJ Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AFV20092
Position
complement(4271027..4273381)
Genome map
AA seq 784 aa AA seqDB search
MKGVILAGGKGRRLRPLTCNTPKPMLPLLEKPVLEYNIELLRQHGIREIAITVQYMSTTI
KRYFGDGSKWGVNLYYFEDSPPLGTAGSIKQAEQFLDETFVVISGDALTDFQLSEGIRFH
EQKRRMVTMFVKEVENPLSFGLVVMNKDQEVTRYIEKPGWNEVVSNVVNTGIYIMEPEIF
SYIPPRQFFDFSHDVFPLLANKNVLFAYLSEGYWLDIGTFNQYRQAQFDLLTKKLQVPIP
YTEVLPMVWMGEGVTIGKGTKIHGPSFIGEGAKIGTGAVIEPYSIIGKNSIVSNYSHLQK
SIVFANAHIGKYCELLETTIGERTIVEDDVTLFQKSIVADHCHIGRSTIIKQKGKLWPYK
AIDSHSIVGAAGIQESEMSAGWLQKSRIVGRGNVEITPQFIVKIAMAYGSLFTKGESILI
GSQENIETTSYKNLFLHAIHGIGIHTMECKEMNESLFQYSVHHLQCAGGVFIQVENENEI
VIKLYGQAGMPLTYKQQKEIEQVYMSELFYYVHEKEMGRNKLVHVSMNEYIEVILGHIDI
EKIQMQKFHLLINKRNDTLQHLLMLFLQRLGCTVTWIYASEQKDHVKALMKSSKANMALM
FSEQGNHFELYDKHSNIYQGTDLEEVDIPDFLLESTGNIYPMSLKLGECYLLFYTQDERK
SFQVRWKRDILYRIGKLFELIALQGKTFLSIVEQSPPLYLLYDEVVCSWNEKGKIMRKLL
DDIERKGEGIFEGVQFKYTEKEWSYIVSDTKQPKFLVYSHARNPVIARENMKNLIEKIRQ
YQKV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggttattttagctggaggaaaaggaagacgccttagaccattaacatgtaat
actccaaagccgatgttaccattattagaaaaaccagttttagaatacaatattgagtta
ttacgccagcatggtattcgtgaaattgcaattactgttcaatatatgagtacgacgatt
aagcgatattttggtgatggtagtaaatggggagttaacttgtattattttgaagactct
cctccgcttggtacagcagggagtattaaacaagcagaacaatttttagatgaaacattt
gttgtaataagcggggatgcattaactgactttcaattatcagaaggaattaggtttcat
gaacaaaagagaagaatggtaacaatgtttgtgaaagaagtagaaaatccactctcattt
ggattggttgtaatgaataaagaccaggaggttacacgatatatagaaaagccgggctgg
aatgaggtagtatctaatgttgtgaatacaggcatatatattatggagccagaaatcttt
tcttacataccgcctagacaattttttgatttcagtcatgatgtgtttccgttattggca
aacaaaaatgtgttattcgcatatttgtcagaaggttattggttagatatcggcacattt
aatcaatatcgacaagcacaatttgatttgttaacgaaaaagttacaagtacctattcct
tatacggaagtattaccgatggtatggatgggagaaggggtgacgattgggaaagggaca
aaaattcatggcccctctttcattggagaaggagcaaagattggtacaggagctgtaatt
gagccatattctattattggaaaaaatagtatcgtttcaaattattctcatcttcaaaaa
agtattgtttttgcaaatgcccatattggaaagtattgtgaactattagaaacgacaata
ggagagcgtacaatagttgaagatgacgttacactgtttcaaaaaagcattgtagcggat
cactgtcatatcgggagaagtacgataattaagcaaaaaggaaaactatggccttataag
gcgattgatagtcattcgatagtaggagcggctggtattcaagagagtgaaatgagtgca
gggtggttacaaaaaagccgcattgtaggaagagggaatgttgaaattactccccagttt
atcgtgaagattgcgatggcgtatggctctctttttacaaaaggagaaagtatattaatt
ggaagtcaagaaaatatagaaacaacctcttataaaaatttatttttacatgctattcat
ggtatagggattcatacgatggaatgcaaagaaatgaacgagtcactttttcaatatagt
gttcatcatttgcaatgtgcaggtggggttttcattcaagtggagaatgagaatgagatt
gttataaagttgtatggtcaagctggcatgccgttaacgtataagcagcaaaaagagata
gaacaagtatatatgtccgaattgttttattacgtgcatgagaaagagatggggcgaaat
aagctggttcatgtttctatgaatgagtatatagaagttatattggggcatattgatatc
gagaaaatacagatgcagaagtttcatcttcttattaataagagaaatgatacgttgcaa
catttacttatgctctttctacaaagacttggttgtacagttacatggatttatgcaagc
gaacaaaaagatcatgtgaaagctttgatgaaatcaagtaaagcgaatatggctcttatg
ttttctgagcaaggaaatcatttcgagttatacgataaacatagtaatatttaccagggt
acagatttggaagaggtagatattccagatttcttactcgaatctacaggaaatatttac
ccaatgtctttgaaattaggagaatgttatcttctgttttatacgcaggatgaaaggaag
tcgtttcaagtaaggtggaagcgagatattttatatcgaattggaaaattatttgagcta
atagcattgcaaggaaaaacgtttctgagcatagtagagcaatcacctccgctctattta
ctttatgatgaagtggtatgttcatggaatgaaaaagggaaaattatgaggaaattattg
gatgatattgaaaggaagggagaaggtatatttgaaggagtacagttcaaatatactgaa
aaagagtggtcttatatcgtttctgacacaaaacaaccaaaatttttagtgtattcacat
gctagaaacccagtaatagcaagggaaaacatgaaaaatcttatagaaaaaattagacaa
tatcaaaaggtgtag

DBGET integrated database retrieval system