KEGG   Bacillus thuringiensis Bt407: BTB_c44150Help
Entry
BTB_c44150        CDS       T02277                                 

Gene name
pstS2
Definition
(GenBank) phosphate-binding protein PstS
  KO
K02040  
phosphate transport system substrate-binding protein
Organism
btg  Bacillus thuringiensis Bt407
Pathway
ABC transporters
Two-component system
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:btg00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BTB_c44150 (pstS2)
  Signal transduction
   02020 Two-component system
    BTB_c44150 (pstS2)
Transporters [BR:btg02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    BTB_c44150 (pstS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4277358..4278275)
Genome map
AA seq 305 aa AA seqDB search
MKWMRTPIIIFVLSIWFLCFEMSTAFALNDMGEVRVDGSSTVFPIIEAVAEEYTKVHPDV
KISISVSGTGGGFNRFSKGEVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIVVN
RHNTWVDDMSVDELRLLWSEDGREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQ
NHRIVKKVSLSEDDQVIMQGVMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQS
GKYKPLSRPLLTYVNNASIRNKMNVANYVEFMIQHVGNLAEEVGYVKLRKEKYNEQLRML
TEIIR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatggatgcgtacaccgattataattttcgtactatcgatatggttcctctgtttt
gaaatgtctactgcatttgctttaaatgatatgggagaagtgagagttgatggatcctca
acggtttttcctattatagaagcagtagcggaggaatatacaaaggtgcatccagacgtg
aaaatttccatcagtgtttctggaactggaggaggatttaatcgtttcagtaaaggagaa
gtagatataaataatgcttcgagagtaatgaaacaagtcgagaaaaatgagatgaagaaa
aactctattcagttcacaccttttgaggtcgctaacgatggtcttacaattgttgtgaat
cggcacaatacatgggtagacgatatgtcagtagacgagttacgtttactgtggagtgaa
gatggaagagagaagcgatggtcacaaattcattcaacatggccacgtgaacaagtgaag
ttttatgcaccaggcgtagactctggtacttatgattattttcaaaatgtcatcttacaa
aatcatcgcattgtaaaaaaagtctctttgtctgaagatgatcaagttattatgcaaggg
gtaatgaatgataaacatgccattgcttttgtaggatatgcttattatatggctaatcga
gataaggtgaaagcaataaaagtgaatggtgtatttccgacgaaagagaccattcagtca
gggaagtataagccgttatctaggccgctacttacttatgtgaataatgcatctatccga
aataaaatgaatgtagcaaactatgttgagtttatgattcagcatgttggtaacctcgct
gaagaggtcgggtatgtaaaattacgaaaagaaaaatacaatgaacagctgcgtatgtta
acagaaataataaggtaa

DBGET integrated database retrieval system