KEGG   Bacillus thuringiensis Bt407: BTB_c44170Help
Entry
BTB_c44170        CDS       T02277                                 

Definition
(GenBank) major facilitator transporter
  KO
K08222  MFS transporter, YQGE family, putative transporter
Organism
btg  Bacillus thuringiensis Bt407
Brite
Transporters [BR:btg02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Putative YqgE transporter (YqgE) family [TC:2.A.1.33]
    BTB_c44170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 OAM_alpha
Motif
Other DBs
NCBI-ProteinID: AFV20099
Position
complement(4280846..4282123)
Genome map
AA seq 425 aa AA seqDB search
MKWKHIIGDVEVNRDLVLLLLIGGLYTLAISLSNTFVNIYLWKQTQNYVNLGLYNLASVI
LQPLTFLVGGKLAKRIDRSILLRIGVGTLAIFFIVVLVAGKSASQYILLMGALLGVGYGF
YWLAFNLLTFEITEPETRDFFNGFLGLLTSFSGMIGPIAAGYTISRMEKWSGYTVIFFLS
LVLFAIAVVLSFFLSKRECEGRYEIVQVLKERRIDKNWGKITRAHFFQGLREGTFIFVIS
VYVYLATNSEFALGKYSLVNSAVSFVCYYLVARMLKKEWRKKAILLGGIILYAVVFLVIF
NVTYTKLLIYAACIAIAYPILLVPYGSMTYDVIGRAKNAREWRVEYVVVRELWLNAGRIC
SILSFLCAVLFFPPEKSLPYLLCILGAGHFLIYFAVKNVKYDEGNASKASVVTQGNAQNQ
TEPEG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaaacatataattggtgacgttgaagtgaatcgggatttagtgttattgctc
cttataggaggtttatacacgctcgcaatttctttatcgaatacgtttgtaaatatttat
ttatggaaacaaacacaaaattatgtgaatcttggcttgtataatttggccagcgttata
ttacagcctctcacatttcttgtagggggaaaattagcgaaacgtatcgatcgctcgatt
ttattacgaataggagtagggacgctcgcaattttttttattgttgtcttagtagcgggg
aaaagtgcttctcagtatattttattaatgggggctcttttaggagtaggatacggtttt
tactggttggcttttaacttattgacatttgaaattacagaaccagaaacaagagatttc
tttaatgggtttcttggacttcttacatccttctctgggatgatcggaccaatagcagca
ggatacacaatttcacgtatggagaaatggagtggttatactgttatattctttctttca
ttagttctatttgcaattgctgtcgtcttaagcttctttttatctaaaagagaatgtgaa
gggcgttatgaaatcgtgcaagtattgaaagaacgacggattgataaaaattggggaaag
attacacgagctcattttttccaaggattgagagaaggaacgtttatttttgtcatttca
gtatatgtttatttagcaactaatagtgagtttgcattagggaaatatagtttagtgaac
tctgctgtatcctttgtatgttattacttagttgctcgtatgttaaagaaggagtggcga
aaaaaagcaattttacttggaggcattattttatatgctgtcgtctttttagttattttc
aatgttacatacacgaaattacttatttatgcggcatgtattgcgattgcatatcctatt
ttacttgttccgtatggatcaatgacatatgacgtaattggtagagcgaaaaatgcgaga
gaatggcgtgtggaatatgtcgttgttcgggagctatggttaaacgccggaagaatctgt
tccattttaagttttttatgtgctgtactattctttccacctgaaaaaagtttaccttac
ttattatgtattttaggtgctggacattttcttatttattttgcagttaaaaatgtcaaa
tatgatgagggaaatgcgagtaaagcaagtgttgtaacgcaagggaacgcgcaaaaccaa
actgaaccagaaggttaa

DBGET integrated database retrieval system