KEGG   Bacillus thuringiensis Bt407: BTB_c44220Help
Entry
BTB_c44220        CDS       T02277                                 

Gene name
ispG
Definition
(GenBank) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG
  KO
K03526  
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTB_c44220 (ispG)
Enzymes [BR:btg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     BTB_c44220 (ispG)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     BTB_c44220 (ispG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
4284734..4285846
Genome map
AA seq 370 aa AA seqDB search
MNEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVA
VPDERAADAIADIKKQINIPLVADIHFDYRLALKAIEGGIDKVRINPGNIGRRHKVEAVV
NAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKA
SDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILSKGIGNTLRISLSA
DPVEEVKVARELLKSFGLASNAATLISCPTCGRIEIDLISIANEVEEYISTLQVPIKVAV
LGCAVNGPGEAREADIGIAGARGEGLLFRKGQVVRKVPEETMVEELKKEIDVIAAEMAAE
REKEKETQEQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaatgactcatcgtacaaaaacacgtccagttaaagtcggtaatttaacaatc
ggcggtaataatgaattaattatacaaagtatgacaacaacaaaaacacatgatgttgaa
gcaacagttgctgaaatcaagcgtttagaagaagctggctgtcaagtcgtccgtgttgcc
gttccagatgaacgcgcagcagatgctattgctgatataaaaaaacaaatcaacattcca
cttgttgctgatattcattttgattatcgccttgctttaaaagcaattgaaggtggcatc
gataaagtacgtatcaatccaggtaatattggtcgtcgccataaagtagaagctgttgta
aatgcagcaaaagagcgcggtattccaatccgtattggtgtaaacgctggttcattagag
cgtcacattttagaaaaatacgggtacccaactgcagatggtatggttgagagcgcgcta
catcatattaaaattttagaggacttagatttccacgatattatcgtatctatgaaagcc
tctgatgttaacttagcaatcgaagcatacgagaaagctgctcgcgcttttgattaccca
ttacatttaggtattacagaatctggaacattgtttgctggaactgtaaaaagtgccgct
ggtcttggagcaatcttaagtaaaggcatcggaaatacactacgtatttcattaagtgct
gatccagttgaagaagtaaaagttgctcgtgaattattaaaatcattcggtcttgcttct
aacgcagcgacacttatctcttgtccaacttgtggtcgtattgaaatcgatttaattagc
atcgctaacgaagtggaagaatacatctctacacttcaagtaccaattaaagttgcagta
cttggttgcgctgtaaatggtcctggtgaagctcgtgaagctgatatcggtattgctggt
gcacgtggagagggattattattccgtaaagggcaagtcgttcgtaaagtaccagaagaa
acaatggtagaagaactgaaaaaagaaatcgacgtaattgctgctgaaatggctgctgaa
cgagaaaaagaaaaagagacacaagaacaataa

DBGET integrated database retrieval system