KEGG   Bacillus thuringiensis Bt407: BTB_c44390Help
Entry
BTB_c44390        CDS       T02277                                 

Gene name
recO
Definition
(GenBank) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:btg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BTB_c44390 (recO)
DNA repair and recombination proteins [BR:btg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BTB_c44390 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BTB_c44390 (recO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecO_C RecO_N RecO_N_2
Motif
Other DBs
NCBI-ProteinID: AFV20120
Position
complement(4301979..4302725)
Genome map
AA seq 248 aa AA seqDB search
MFQKVEGIVIRTTDYGETNKIVTIFSRELGKVSAMARGAKKPKSRLASVSQLMTHGHFLI
QMGSGLGTLQQGEIISTMKEIREDIFLTAYASFIVELTDKATEDKKHNPYLFEMLYQTLH
YMCEGVDPEVLSLIYQTKMLPVLGMRPYFDTCAICHQETDFVAFSVREGGFLCSRHAEQD
PYRIPVGEAVHKLLRLFFHFDLHRLGNVSVKDSTKKQMRLVLNTYYDEYCGIYLKSRRFL
EQLDKFQI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaaagttgagggcatcgttatccgtacgacagattacggagaaacgaacaag
attgttacaatattctcaagagaacttggtaaggtaagtgcaatggcaagaggggcaaaa
aaaccgaaaagccgattagcatctgtgtcgcaattaatgacacatggccattttcttatt
caaatgggatctgggcttggaacattgcaacaaggcgagattatttcaactatgaaagaa
attcgcgaggatatatttttaactgcttatgcatcatttattgttgagttaactgataaa
gcaacagaagataaaaaacataatccgtatttatttgaaatgttatatcaaacgttgcat
tatatgtgtgagggtgttgatccagaagtattatcattaatttatcaaacgaaaatgctt
ccggtattagggatgcgcccgtactttgatacatgtgcgatttgtcatcaagaaacagac
tttgtcgccttctccgtaagggaaggcggttttctgtgctcacgtcatgcagagcaagac
ccatatcgtataccggtaggagaagctgttcataaattattacgtcttttcttccatttc
gatttacataggctcggaaatgtatcggtaaaggatagcacaaaaaaacaaatgcgttta
gtattgaatacatattatgatgaatattgcggaatttatttgaaatcaagacgtttttta
gaacaacttgataagtttcaaatataa

DBGET integrated database retrieval system