KEGG   Bacillus thuringiensis Bt407: BTB_c44480Help
Entry
BTB_c44480        CDS       T02277                                 

Gene name
yqfC
Definition
(GenBank) uncharacterized protein YqfC
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YabP
Motif
Other DBs
NCBI-ProteinID: AFV20129
Position
complement(4309955..4310248)
Genome map
AA seq 97 aa AA seqDB search
MKKLEQMKNWLTKQVDLPVDVLMDLPRITLVGQIHIYIENHRGLLVFSDKEVRLLLKHGQ
LLIKGQSFVIKTILPEELLLEGIIEQVTFLENEKKGD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattagaacaaatgaaaaattggttaacaaaacaagtagacctaccagtggat
gtattaatggatctgcctcggattactcttgttgggcaaatacatatttatatagaaaat
catcgggggctattagtgttttcagataaagaagtgcgattgcttttaaaacatggtcaa
ttactaattaaaggacaatcctttgttattaaaacgattcttccagaagagcttttactc
gaagggataattgagcaagtaacatttttagaaaatgaaaaaaaaggtgattga

DBGET integrated database retrieval system