KEGG   Bacillus thuringiensis Bt407: BTB_c44560Help
Entry
BTB_c44560        CDS       T02277                                 

Gene name
dnaK
Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:btg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BTB_c44560 (dnaK)
Messenger RNA biogenesis [BR:btg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BTB_c44560 (dnaK)
Chaperones and folding catalysts [BR:btg03110]
 Heat shock proteins
  HSP70 / DNAK
   BTB_c44560 (dnaK)
Mitochondrial biogenesis [BR:btg03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    BTB_c44560 (dnaK)
  Matrix
   MMC/PAM proteins
    BTB_c44560 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    BTB_c44560 (dnaK)
Exosome [BR:btg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BTB_c44560 (dnaK)
  Exosomal proteins of breast cancer cells
   BTB_c44560 (dnaK)
  Exosomal proteins of colorectal cancer cells
   BTB_c44560 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl DASH_Spc19
Motif
Other DBs
NCBI-ProteinID: AFV20137
Position
complement(4316930..4318765)
Genome map
AA seq 611 aa AA seqDB search
MSKIIGIDLGTTNSCVAVMEGGEPKVIPNPEGNRTTPSVVAFKNEERQVGEVAKRQAITN
PNTIMSVKRHMGTDYKVEVEGKDYTPQEISAIILQNLKASAEAYLGETVTKAVITVPAYF
NDAERQATKDAGRIAGLEVERIINEPTAAALAYGLEKQDEEQKILVYDLGGGTFDVSILE
LADGTFEVISTAGDNRLGGDDFDQVIIDHLVAEFKKENNIDLSQDKMALQRLKDAAEKAK
KDLSGVTQTQISLPFISAGAAGPLHLELTLTRAKFEELSAGLVERTLEPTRRALKDAGFA
PSELDKVILVGGSTRIPAVQEAIKRETGKEPYKGVNPDEVVALGAAVQGGVLTGDVEGVL
LLDVTPLSLGIETMGGVFTKLIERNTTIPTSKSQVFSTAADNQPAVDIHVLQGERPMSAD
NKTLGRFQLTDLPPAPRGIPQIEVTFDIDANGIVNVRAKDLGTSKEQAITIQSSSGLSDE
EVERMVQEAEANADADQKRKEEVELRNEADQLVFQTDKVVKDLEGKVDAAEVAKATEAKE
ALQAAIEKNELEEIRAKKDALQEIVQQLTVKLYEQAQAAAGQAEGAQGAQDAGTKKDNVV
DAEFEEVKEDK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattatcggtattgacttaggtacaacaaactcttgtgtagctgttatggaa
ggtggagaaccaaaggttatcccaaatccagaaggaaaccgtacaacaccttctgttgta
gctttcaaaaatgaagaacgtcaagttggggaagttgcaaagcgccaagcaattacaaac
ccaaatacaatcatgtctgttaaacgtcatatgggtacagactacaaagtagaagttgaa
ggtaaagattatacacctcaagaaatttctgcaatcattttacaaaacttaaaagcttct
gctgaagcatacttaggtgaaacagtaacgaaagctgttattacagtacctgcatacttc
aacgatgcagagcgtcaagcaacgaaagatgctggtcgtatcgctggtttagaagttgag
cgtatcattaacgagccaacagcagcagcacttgcttacggtttagaaaaacaagacgaa
gaacaaaaaatcttagtatatgacttaggtggcggtacatttgacgtatctatccttgag
ttagcagacggcacattcgaagttatttcaactgctggtgacaaccgtcttggtggcgat
gactttgaccaagttatcatcgatcacttagtagctgagttcaaaaaagaaaataacatt
gatttaagccaagataaaatggcgcttcaacgcttgaaagatgcagctgaaaaagcgaaa
aaagatctttctggtgtaacacaaactcaaatttcattaccattcattagtgctggagct
gctggtccattacacttagaattaacgttaacaagagcgaaattcgaagagctttcagca
ggtcttgttgaaagaacattagagccaactcgtcgtgcattaaaagacgctggttttgct
ccaagcgaattagataaagttattcttgttggtggatctactcgtatcccagctgtacaa
gaagctattaaacgtgaaactggtaaagagccatataaaggtgtaaaccctgatgaagtt
gtagcattaggtgctgcagttcaaggtggcgtacttactggtgatgtagaaggcgttcta
ttattagacgtaactccactttctttaggtattgaaactatgggtggcgtgttcacgaaa
ttaatcgagcgtaacactacaattccaacaagtaagtcacaagtattctcgacagctgct
gataatcaaccagcagtagacattcacgtattacaaggtgagcgtccaatgtcagctgac
aacaaaacgttaggtcgtttccaattaactgaccttccaccagcaccacgtggtattcca
caaatcgaagtaacattcgatattgatgcgaacggtatcgttaacgtacgtgcgaaagac
ttaggaacaagcaaagagcaagctattacaatccaatcttcttcaggtctttctgatgaa
gaagtagaacgtatggtacaagaagcggaagcaaatgctgacgctgatcaaaaacgtaag
gaagaagttgaacttcgtaacgaagctgaccaacttgtattccaaacagacaaagttgta
aaagatttagaaggtaaagtagatgcagctgaagttgcaaaagcaacagaagcgaaagaa
gcattacaagctgcaattgagaaaaacgagcttgaagaaattcgtgcgaaaaaagatgct
ttacaagaaatcgtacaacaattaactgttaaattatacgagcaagctcaagcagctgct
ggtcaagcagaaggtgcgcaaggtgcacaagacgctggcacgaagaaagacaatgtagtt
gacgctgagtttgaagaagtaaaagaagacaagtaa

DBGET integrated database retrieval system