KEGG   Bacillus thuringiensis Bt407: BTB_c44570Help
Entry
BTB_c44570        CDS       T02277                                 

Gene name
grpE
Definition
(GenBank) protein GrpE
  KO
K03687  
molecular chaperone GrpE
Organism
btg  Bacillus thuringiensis Bt407
Brite
Chaperones and folding catalysts [BR:btg03110]
 Heat shock proteins
  HSP24
   BTB_c44570 (grpE)
Mitochondrial biogenesis [BR:btg03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    BTB_c44570 (grpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4318792..4319358)
Genome map
AA seq 188 aa AA seqDB search
MEERNEQVVEEVKEAQVEEAVTPENSEETVEEKSEAALLQEKVDELQAKLTETEGRTLRL
QADFENYKRRVQMDKQAAEKYRAQSLVSDILPALDNFERAMQVEATDEQTKSLLQGMEMV
HRQLLEALTKEGVEVIEAVGKQFDPNEHQAIMQVEDSEFESNAVVEEFQKGYKLKDRVIR
PSMVKVNQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagcgtaacgaacaagtggtagaagaagtaaaagaagcgcaagttgaagaagct
gtcacgccagaaaacagtgaagaaactgtagaagaaaaaagtgaggctgctcttttacaa
gaaaaagtagatgagttacaagcgaaactaacggaaacggaaggtcgcacattacgtcta
caagctgattttgaaaattataagcgccgtgtccaaatggataaacaggctgctgaaaaa
tatagagcacaaagtctagtttcagacatcttgccagctcttgataattttgaaagagca
atgcaagtggaagcgactgatgagcaaacgaaatccttgttacaaggtatggaaatggtg
catcgtcaattgttagaagcgctgactaaagaaggtgtggaagtgattgaagctgttggt
aaacagtttgatcctaatgaacaccaagctattatgcaagtggaagatagtgaatttgaa
tcaaacgcggttgtggaagaattccaaaaaggttataaattaaaagaccgtgtgattcgc
ccatcaatggtaaaagtaaatcaataa

DBGET integrated database retrieval system