KEGG   Bacillus thuringiensis Bt407: BTB_c44600Help
Entry
BTB_c44600        CDS       T02277                                 

Gene name
hxlR
Definition
(GenBank) HTH-type transcriptional activator HxlR
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_20 MarR Replic_Relax
Motif
Other DBs
NCBI-ProteinID: AFV20141
Position
complement(4321814..4322188)
Genome map
AA seq 124 aa AA seqDB search
MSENIRKDIQDKIQNGNFNCEKELTLSIISGKWKVVILWHLGVEGPHRFSELQRLFPSIS
HKVLSNQLKELMEDGIVDRTVYPEIPPRVEYYMTELGMSLLPIVEMMYDWGKMRMEQIRN
TLEK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaaatattcgaaaagatattcaagataaaatacaaaatggcaattttaattgt
gaaaaggaattgacgctttctattattagtggaaagtggaaagttgtgatactgtggcat
cttggtgtggaagggcctcatcgttttagtgaattacaacggttattcccaagcatttct
cataaagttttgtcgaaccaattaaaagagttaatggaagatgggattgttgatcgaaca
gtatatcccgaaattcctcctcgtgttgagtattatatgacggaactaggcatgtcactt
ttaccgatcgttgaaatgatgtatgattggggaaaaatgcgaatggaacaaattcgtaat
acgttagagaagtag

DBGET integrated database retrieval system