KEGG   Bacillus thuringiensis Bt407: BTB_c44670Help
Entry
BTB_c44670        CDS       T02277                                 

Gene name
comEC2
Definition
(GenBank) ComE operon protein 3
  KO
K02238  competence protein ComEC
Organism
btg  Bacillus thuringiensis Bt407
Module
btg_M00429  Competence-related DNA transformation transporter
Brite
Secretion system [BR:btg02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BTB_c44670 (comEC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Competence DUF4131 Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: AFV20148
Position
complement(4327864..4330185)
Genome map
AA seq 773 aa AA seqDB search
MQEQWGYVAISFIIGIAIAFSSSLLLIVFCLFLNVFFCLYRTSRKTFFFCIVACFSGAIY
TSYVQGWNKSLGESYGVTRGVIQNTPLVNGDRLSFQFEDHNKNIVQLSYRIKSALEKEKM
QQLYAGISCVFEGERKEPQTARNFHGFNYRDYLYKQHIHFTFEATYISECYKTSLSLIQR
ILLLRQQVISKVTEMFPEQSGAFMNALLFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIV
LLMVIVYFILLRSGATREVAIICLIICIPLYMVLAGASPSVIRASITGVLTLIAFMCSIR
LSSLDALSVTAICMLIYDPYLVFNIGFQFSFVGSFALLLSAPLLLVSSNGVIRNSIYISI
ISQLVSTPILLYHFGYFSPYSIFLNLLYVPFLSTIVLPCSIIILLCMPIVPFLAKGFADV
LSIGLSMSNVFLSYCESLPFNQLIFGKTSFNLVAVYCASIVSILMVWERRAPKKMVCIVV
SIFLFISTCHYVYPYFRGSGSVTFIDVGQGDAILIRLPYDKGVYLIDTGGTLRVNKEEWQ
QKKHEFSVGNDVLIPYLQKEGIKTIDKLIVTHGDADHIGAAQELLSYIPVKEVVFGRKGK
DAVLEKVVKKQALEKEMKITEVGEGENWSVNEAEFFVLAPKGKEKSENNASIVIWAKFGG
LTWLFTGDLEEEGEQFLVSAYPDLRVDVLKVAHHGSNTSSIESFLNVIQPRVAIISVGKQ
NRYGHPHKEVIERLEKMGSAIWRTDKQGAISYVFKGENGTFQSKITYDKTYNR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggaacaatgggggtatgttgcaatctcgtttataatagggattgcaattgccttt
tcctcgtcacttttattgatagttttttgcctctttttaaatgttttcttctgtttatat
cgcacttcgcgtaaaaccttctttttttgcattgtagcgtgctttagtggcgctatatac
acttcctatgttcaagggtggaataagtctctaggagagtcctatggagttacaagaggg
gttatacaaaatacaccgcttgttaatggagatcgcctatcttttcagtttgaagatcac
aataaaaatatagtgcagttaagttatagaataaaatcagccttggaaaaggaaaaaatg
caacaattatacgcagggatatcatgtgtattcgagggtgagaggaaagaaccgcaaaca
gctcggaattttcatggttttaattaccgtgattatttatacaagcaacatattcatttc
acatttgaggctacatatatttctgaatgctataaaacatcactgtcgctcatacaacgg
attctccttttgaggcaacaagtaatctcgaaagttacagagatgtttccagagcaatca
ggtgcttttatgaatgcgttactatttggtgatagacaacaaatgacgtttgaagtggaa
gagcaatatcaacagtttggtcttgtacatttgttagcaatttcaggttcgcacattgta
ttgttaatggtgatagtatattttattttgctaagaagtggtgcgacgagggaggtagca
ataatttgccttatcatttgtattcctttgtatatggttttagcaggagcgtcaccctct
gttataagggcttctataacaggagttttgacgttgattgcttttatgtgctcgattcgt
ttatctagtttagatgctttaagtgtaacagctatatgtatgcttatatatgacccttat
cttgtttttaatattggatttcagttttcttttgtaggtagcttcgctttacttttgtct
gctccgttattgttagtgagtagcaacggagtaatccgaaattctatttatatttctatc
atttcacagctcgttagtactccgattttgttatatcactttggttatttttctccatat
agcattttcctcaatcttttatacgttccgtttttatctaccattgtattaccatgtagc
attattattttactgtgtatgccaattgtcccgtttctcgcaaaaggatttgcggatgtg
ttatcaataggcttgagtatgtctaatgtttttctaagttattgtgaaagtttaccattt
aaccagcttattttcgggaaaacgtccttcaatcttgtagctgtatattgcgcgagtatt
gtcagtatattgatggtttgggaaaggagagcgccgaaaaaaatggtttgtatagttgtg
agtatatttctttttattagcacgtgtcattatgtatatccatattttagaggaagtgga
agtgtaacatttattgatgttggacaaggtgatgcaatattaattcgccttccgtatgat
aaaggggtttatcttattgatacaggtggaacgcttcgtgtcaataaggaagagtggcaa
caaaaaaagcatgaattttctgttggaaatgatgttttaataccctatttacaaaaagaa
ggtattaaaacaattgataaattaatcgtaacgcatggagatgcagatcatataggtgct
gcgcaagaattattatcatatatacctgtaaaagaagttgtgtttggccggaagggaaaa
gatgcagtattagaaaaagtagtaaagaaacaggcattagaaaaggaaatgaaaataact
gaagtgggggaaggggaaaattggagtgtaaatgaagctgaatttttcgttttagctcca
aaaggaaaagaaaaaagtgaaaataatgcttcaattgtaatatgggcaaaatttggagga
ttgacgtggctatttacaggcgatttagaagaagaaggagagcagtttttagtatctgcg
tatccagatttgcgagtagatgttttaaaagttgctcatcatggaagtaacacgtcatct
atagagtcttttttgaacgttatacagccccgtgtagcgattatatctgttggtaagcag
aatagatatggacacccgcataaagaagtgatagagcgtttggagaagatggggagtgcg
atatggcgcacggacaagcaaggtgctatttcctatgtttttaaaggggaaaatggaacc
tttcaaagtaaaatcacatacgataagacatataataggtga

DBGET integrated database retrieval system