KEGG   Bacillus thuringiensis Bt407: BTB_c44730Help
Entry
BTB_c44730        CDS       T02277                                 

Definition
(GenBank) HAD superfamily hydrolase
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD
Motif
Other DBs
NCBI-ProteinID: AFV20154
Position
complement(4333605..4334174)
Genome map
AA seq 189 aa AA seqDB search
MNRENALHIVKQQMHEKRYIHTIGVMETAIELAKLYGVDEKKAEMAAIFHDYAKCRAISE
MEEIIKREDLPKDLLCYNKELWHAPVGAYLVEKEVGITDSEILQAITYHTSGHENMTMLD
KVIYVADYIEPGRKFPGVEEARKLAYTDINQALLFALKRTIQFLMEKNQTIYPLTFQTYN
AVIKEEMSK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtgagaatgcacttcatattgtcaaacaacaaatgcatgaaaaacgttatata
cacacaattggtgtaatggagacagcgattgagcttgctaagttatacggtgtggacgag
aaaaaagcagagatggcagctatattccatgattatgcgaaatgtagagcaatttcagag
atggaagagattattaaacgtgaagatttgccgaaagatttactttgctataataaagag
ttgtggcatgcgcctgttggggcatacttagtagaaaaagaggtaggcattacggattct
gaaatattgcaagctattacatatcatacaagtggtcatgagaacatgacgatgttagat
aaagtgatttatgtagctgattacattgagccagggcgaaagtttccaggtgtggaagag
gctcgtaaactcgcatatacggatataaatcaagctttattatttgccttaaagagaaca
attcaatttttaatggaaaaaaatcagacgatttatccattaacattccaaacatacaat
gcagttatcaaggaggaaatgagtaaatga

DBGET integrated database retrieval system