KEGG   Bacillus thuringiensis Bt407: BTB_c44790Help
Entry
BTB_c44790        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
  KO
K06371  developmental checkpoint coupling sporulation initiation to replication initiation
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sda
Motif
Other DBs
NCBI-ProteinID: AFV20160
Position
4337889..4338044
Genome map
AA seq 51 aa AA seqDB search
MKTKHMEQLSTELLTESYYKAKELKLNPDFILLIKQEIIRRSLEDKLVKSS
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaaaacatatggaacagttatccactgagttactcactgagtcttattataaa
gcaaaagaactaaaattaaatcccgacttcattttacttataaaacaagaaatcattaga
cgctcattagaggacaagcttgtcaaatcttcttga

DBGET integrated database retrieval system