KEGG   Bacillus thuringiensis Bt407: BTB_c45030Help
Entry
BTB_c45030        CDS       T02277                                 

Definition
(GenBank) dehydrogenase with MaoC-like domain
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N 4HBT
Motif
Other DBs
NCBI-ProteinID: AFV20184
Position
complement(4360515..4360892)
Genome map
AA seq 125 aa AA seqDB search
MSVKAGDVFKYERRFTEEEVFEFANITGDKGRHHVEYDENGRLMVHGLLTASIGTKVGEE
LHYIARELVSEFIRPVFTGDTITCELTLTNVEQMEGYKKVSIESVYRNQHEKTVLVGTSY
GIIRG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaaagctggggatgtatttaaatatgaaagaagatttactgaggaagaagtt
tttgaatttgcaaatattaccggtgataaaggtagacaccatgtggaatacgatgaaaat
ggaagattaatggttcatggtttattgactgctagcattggaacgaaagtgggagaagag
ttacattacatagcaagagaattagtaagtgagtttattagaccagttttcacaggagat
acgatcacttgtgaactaactttaacaaatgttgagcaaatggaaggctataaaaaagtt
tcaatcgagtcagtttatcgcaatcagcatgaaaagactgtactagttgggacaagttat
ggaattataaggggataa

DBGET integrated database retrieval system