KEGG   Bacillus thuringiensis Bt407: BTB_c45090Help
Entry
BTB_c45090        CDS       T02277                                 

Gene name
isdE1
Definition
(GenBank) high-affinity heme uptake system protein IsdE
  KO
K02016  iron complex transport system substrate-binding protein
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg02010  ABC transporters
Module
btg_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:btg00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BTB_c45090 (isdE1)
Transporters [BR:btg02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BTB_c45090 (isdE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 Turandot
Motif
Other DBs
NCBI-ProteinID: AFV20190
Position
complement(4364712..4365659)
Genome map
AA seq 315 aa AA seqDB search
MKKSITLFTAILSIFFLLIGCSAKGDEKASATKTEKGKEKIEITELSGRKVTFDKVPESF
ATLSMGDMDIIHALGGKVVGRPDTKLTLPEELKKAKVIGNAHQPNFEQIASLKPDVLVAN
NGFQKNVPTVEGQGTKVIISSANSVQDIQKNIELYGTVMKKEDKAKELNQKINDQMKKYE
KKSDVKALLVYGAPGTYLAALPTSLSGDVLEKTGGKNIASDFPETKEYPQYAQLSVERII
EANPDVIYLITHGDPKSVKKAFEGEMMKNEAWKNLDAVKQNRVVILPPDLFGSNPGTKVT
EAMDFMYKSIQDVRK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatctattacgctatttacagcgattttatctatttttttcttgttaataggt
tgcagtgccaaaggggacgagaaagcgtctgcaaccaaaacagaaaaaggaaaagaaaaa
atcgaaattaccgaactgtcagggagaaaggtaacattcgataaagtaccagaaagtttt
gcaacattaagtatgggagacatggatattattcatgctttaggtggaaaagtagtaggt
cgtccggatacgaaattaactcttccagaggagttaaagaaagcaaaagtaatcgggaat
gcacatcaaccgaactttgagcaaattgctagtttaaagcccgatgtacttgttgctaac
aatggattccaaaagaatgtgccaacggttgaaggacagggaacgaaagtaatcatttct
tctgcgaattctgtacaagatattcaaaagaatattgaattatatggaacggtaatgaag
aaagaagataaagcaaaagaacttaatcaaaaaatcaatgatcaaatgaagaaatatgag
aaaaagagcgatgtgaaagcattgctagtgtatggcgcaccaggtacttatttagcggca
ttaccaacatctttatcaggtgatgttttagaaaaaacaggcgggaaaaatattgcttct
gattttccagaaacgaaagaatatccgcaatatgcacagctaagtgtagaacgtattatt
gaggcgaatccagatgtcatttatttaattacacacggagatccaaaaagtgtgaaaaaa
gcattcgaaggcgaaatgatgaaaaatgaagcgtggaaaaatttagatgcagtaaaacaa
aaccgcgtagttattttgccacctgatttatttggatctaatcctgggacaaaagttaca
gaagcaatggactttatgtataaaagtatacaagatgtaaggaaatga

DBGET integrated database retrieval system