KEGG   Bacillus thuringiensis Bt407: BTB_c45160Help
Entry
BTB_c45160        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2536 YabB SBDS_C
Motif
Other DBs
NCBI-ProteinID: AFV20197
Position
4372663..4372878
Genome map
AA seq 71 aa AA seqDB search
MSFTFEMLEDKVEFFEAGDLASLERKISEQIDNNKALMLEVHHISHQMVMDPESKRPYYS
AVVHFKLKKLR
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttacctttgaaatgttagaagataaagtagaattttttgaagcgggagactta
gcttctttagaacgaaaaattagtgaacaaatcgataataataaagcacttatgcttgaa
gttcatcacatctcacatcaaatggttatggatcctgaaagcaaaagaccgtattatagc
gcggttgttcattttaaattaaagaaattgcgttaa

DBGET integrated database retrieval system