KEGG   Bacillus thuringiensis Bt407: BTB_c45200Help
Entry
BTB_c45200        CDS       T02277                                 

Gene name
udk
Definition
(GenBank) uridine kinase Udk
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00240  Pyrimidine metabolism
btg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BTB_c45200 (udk)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     BTB_c45200 (udk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK AAA_18 Zeta_toxin CoaE Gtr1_RagA ABC_tran KAP_NTPase AAA_16 AAA_19 Torsin MobB AAA_28 cobW AAA_33
Motif
Other DBs
NCBI-ProteinID: AFV20201
Position
complement(4376296..4376934)
Genome map
AA seq 212 aa AA seqDB search
MGTNKPVVIGIAGGSGSGKTSVTKAIFDHFKGHSILILEQDYYYKDQSHLPMEERLKTNY
DHPLAFDNDLLIEHLQQLLAYEQIDKPVYDYTLHTRSEEIIPVEPKDVIILEGILILEDP
RLCELMDIKLFVDTDADLRILRRMQRDIKERGRTMDSVIDQYVTVVRPMHNQFIEPSKKF
ADIIIPEGGQNHVAIDIMVTKIATILEQKVNL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaataagcctgttgtaattggaatcgctggtggttcaggatcaggaaaaaca
agtgtaacgaaagcgatttttgaccattttaaaggtcattccattttaatcttggagcaa
gattattattacaaagatcaaagccatttaccaatggaagagcgtttaaaaacaaattat
gatcatccgcttgcgtttgataatgatctgttaattgaacatttgcagcagttgcttgca
tatgagcaaattgataagcctgtatatgactatacattgcatacgcgttcagaagaaatt
attccagttgagccgaaagatgtaattattttagaaggaattcttattttagaagaccca
cgtctttgtgagttgatggacattaagttattcgttgatacagatgctgaccttcgtatt
ctgcgccgcatgcagcgtgatattaaagagcgcggtcgtacgatggattcagttattgat
cagtacgtaactgttgtacgtccaatgcacaatcaatttattgagccttctaagaagttt
gcggatattattatccctgaaggtggacaaaaccatgttgcaattgatattatggtgaca
aaaattgcaacaattcttgaacaaaaagtaaatttgtaa

DBGET integrated database retrieval system