KEGG   Bacillus thuringiensis Bt407: BTB_c45240Help
Entry
BTB_c45240        CDS       T02277                                 

Gene name
yrrL
Definition
(GenBank) YrrL
  KO
K07082  UPF0755 protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG DUF5345
Motif
Other DBs
NCBI-ProteinID: AFV20205
Position
complement(4380033..4381103)
Genome map
AA seq 356 aa AA seqDB search
MIENQVKKKRRRIFLFSIIALLLVCGSVYAYISSALGPVDSGNKKEIEVEIPKGSSTSKI
GEILEEKGAVKNGTVFSFYTKAKSKSLQAGTYLLNPSMNAEDVIEQMSSGNVHRPALYKV
TIKEGAQVTEIAETIATELKWNKDDVTRQLNDKAFIQKMQQKYPKLLTDKIFDSNIKYPL
EGYLYPATYSFYKKDTTLEEIVIPMLEKTNAIIVQNEAKMKAKNWDVHQLLTLSSLIEEE
ATGFTDRQKIASVFYNRLAKGMPLQTDPTVLYALGKHKQRVLYEDLKVNSPYNTYVVKGL
PVGPIANSGKHSVEAALEPAQTDYYYFLAAPSGEVYYAKTLEEHNALKQKYITKKQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgatagagaatcaagtgaaaaagaagcgtagacgcatctttttattttcgattattgca
ctgcttttagtttgtggttcagtctatgcgtatatttcatccgcattaggaccagttgat
agcgggaataaaaaagagattgaagtagaaattccgaaaggatcatctacaagtaaaatt
ggagaaattttagaagaaaaaggcgctgtaaaaaacggtacagtttttagtttttataca
aaggctaaatcgaaaagtttacaagcaggtacatatttattaaacccttcaatgaatgct
gaagatgtgatcgaacaaatgtcatctggcaacgtgcatcgtccagctctttataaagtg
acgattaaagaaggggcgcaagtaactgaaattgcagaaacgattgcgacagaactaaag
tggaataaagatgatgttacgcgtcaattaaacgataaagcatttattcaaaaaatgcag
caaaagtatccgaagttattaacggataaaatctttgatagtaatattaaatacccatta
gaaggttatttatatcctgcaacgtattcgttttataagaaagatacaacgttagaagaa
attgtaattccgatgcttgagaaaacaaatgcaatcattgttcaaaatgaggcgaaaatg
aaagcgaagaactgggatgttcatcagcttttaacattatcttcacttattgaagaagag
gcaactggttttacagatcgtcaaaagatcgctagtgtcttttataatcgtttagcaaaa
ggtatgccgcttcaaacggatccaacggtattatatgcacttggaaagcataaacaacgt
gtattatacgaagacttaaaggtcaactcaccgtacaatacgtatgttgtaaaaggattg
ccggtagggccgatcgcaaactctggtaaacattcagtggaagctgcgttagaacctgcg
caaacagattattattatttcttagctgcaccaagtggtgaagtgtactatgcgaaaaca
ttagaagagcataatgcattaaagcaaaaatacattacgaaaaaacagtga

DBGET integrated database retrieval system