KEGG   Bacillus thuringiensis Bt407: BTB_c45250Help
Entry
BTB_c45250        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1292
Motif
Other DBs
NCBI-ProteinID: AFV20206
Position
complement(4381327..4381605)
Genome map
AA seq 92 aa AA seqDB search
MEENQITIVDEKGNEHLCEIIFTFDAEKFGKKSYVVFSPIGEVDEDGDPIYDAMAYEQNE
EEGGSLLPIESEEEWEMVQEMFNTLADEQEAE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaatcaaattacaattgtagacgaaaaaggtaacgaacatttatgtgaaatt
attttcacttttgatgctgaaaaatttggtaaaaaatcatatgtagtcttctctccaatc
ggtgaagtagacgaagatggagacccaatttatgatgcaatggcttatgagcaaaatgaa
gaagagggcggaagcttacttccaatcgaatctgaagaagagtgggaaatggtacaagaa
atgttcaacactcttgctgatgagcaagaagctgaataa

DBGET integrated database retrieval system