KEGG   Bacillus thuringiensis Bt407: BTB_c45280Help
Entry
BTB_c45280        CDS       T02277                                 

Gene name
alaS2
Definition
(GenBank) alanine--tRNA ligase AlaS
  KO
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:btg00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTB_c45280 (alaS2)
Enzymes [BR:btg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     BTB_c45280 (alaS2)
Amino acid related enzymes [BR:btg01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   BTB_c45280 (alaS2)
Transfer RNA biogenesis [BR:btg03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BTB_c45280 (alaS2)
 Prokaryotic Type
    BTB_c45280 (alaS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4382378..4385020)
Genome map
AA seq 880 aa AA seqDB search
MKQLTGAQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQN
PRITNAQKSIRTNDIENVGKTARHHTFFEMLGNFSIGDYFKEEAITWAWEFLTSDKWIGF
NKELLSVTIHPEDEEAFTIWNEKMGVPKERIIRLEENFWDIGEGPSGPNTEIFYDRGEAY
GNDFSDPELYPGGENERYLEVWNLVFSQFNHNPDGSYTPLPKKNIDTGMGLERMTSIVQD
VPTNFDTDLFMPMIGATESISGEKYRNGDLEKDMAFKVIADHIRTVTFAVGDGALPSNEG
RGYVLRRLLRRAVRYSKKLNINRPFMFELVPVVGEVMKDFYPEVLEKKDFIAKVVKNEEE
RFHETLHDGEAILAEVITKAKEEKTTVISGVDAFRLYDTYGFPIELTEEYAEEAGMTVDQ
EGFENEMEKQRERARAARQDVDSMQVQGGVLGEVKVASEFVGYGTVATESNVVALVKNGE
YTDSLQAGEEGQLMLDVTPFYAESGGQIADRGYLLADGVKVLVKDVQKAPNGQNLHKVVV
EEGTLTKDAAVKAIIDTKNRSSVVKNHTATHLLHQALKDVLGTHVNQAGSLVTSERLRFD
FSHFGQVQADELEKIERMVNEKIWESIDVEISQKAIEEAKEMGAMALFGEKYGDVVRVVQ
VGDYSLELCGGCHVDNTASIGIFKIVAESGIGAGTRRIEAVTGKSAYELMNDQVGLLKEA
AGKMKTNPKDILTRVDGLFAEVKQLQKENESLAAKLSNIEAGNLTDSVMTVDGVNVLAAK
VNVADMNNLRTMMDDLKNKLESAVVVLASVNDDKVNILAGVTKDLIGQGYHAGKLVKEVA
SRCGGGGGGRPDMAQAGGKNPAQVEEALAFVQEYVKSVSK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaactaacaggcgcacaaattcgtcaaatgtttttagactttttccaagaaaaa
ggacatgcagtagaacctagtgcatcactagttccacatgaagatccatctcttctatgg
attaatagtggtgtagctacattgaaaaaatattttgatggacgtgtaatcccacaaaat
ccacgtattacaaatgctcaaaaatcaattcgtacaaacgatattgaaaacgtagggaaa
acagctcgtcaccatacattctttgaaatgttaggaaacttctcaatcggtgattacttc
aaagaagaagcaattacatgggcttgggaattcttaacgagcgacaaatggattggattc
aataaagaattactatcagttacaatccatccagaagatgaagaagcattcacaatttgg
aatgagaaaatgggtgttccaaaagagcgtattatccgcttagaagaaaacttctgggat
atcggtgaagggccaagtggaccgaatacagagattttctatgaccgcggagaagcttac
ggtaatgactttagtgacccagaattatatccaggcggagaaaacgagcgttacttagaa
gtatggaaccttgtattctctcaatttaaccataatccagatggttcatatacaccactt
cctaagaaaaacattgatacagggatgggtctagaacgtatgacatctatcgttcaagat
gtgcctacgaactttgatacagatctattcatgccgatgattggtgcaacagaatcaatt
tctggtgagaaatatcgtaatggcgatttagaaaaagatatggcatttaaagtaattgct
gaccatatccgtacagtaacatttgctgttggtgacggtgctcttccttctaacgaaggc
cgtggttatgtattacgtcgtttattacgccgcgctgttcgttattcgaagaaattaaac
attaaccgtccattcatgtttgaattagtaccggttgttggagaagtaatgaaagacttc
tatccagaagtacttgaaaagaaagatttcattgcgaaagttgtgaaaaacgaagaagag
cgtttccatgaaacacttcatgatggtgaagcaattttagctgaagttattacaaaagca
aaagaagaaaaaacaactgttatttctggagtagatgcgttccgtctatatgacacatac
ggtttcccaatcgaattaacagaagaatatgcagaagaagctggtatgacagttgaccaa
gaaggcttcgaaaatgaaatggaaaaacaacgtgagcgtgcacgtgctgctcgtcaagac
gttgactcaatgcaagttcaaggcggtgtacttggagaagttaaagtagcgagtgagttc
gttggttacggtacagttgcaacagaaagtaacgttgttgcacttgtgaaaaacggcgaa
tacacagacagcttacaagctggtgaagaaggacaattaatgcttgatgtaacaccattc
tatgctgagagcggtggacaaattgcagaccgtggttaccttcttgctgatggcgtgaaa
gttcttgtaaaagacgtgcaaaaagcaccaaatggtcaaaacttacacaaagttgttgtt
gaagaaggtacattaacgaaagatgcggctgtgaaagctattatcgatacgaaaaaccgt
agtagcgttgtgaaaaatcatacagcaactcacttactacaccaagcattaaaagatgta
cttggaacacacgttaaccaagcaggttctcttgtaacttctgaacgtttacgctttgac
ttctctcacttcggtcaagtacaagctgacgaattagaaaaaattgaacgtatggtaaac
gagaaaatttgggaaagtattgatgttgagatttctcaaaaagcaatcgaagaagcgaaa
gaaatgggcgcaatggcattattcggtgaaaaatacggtgatgttgtacgcgttgtacaa
gttggcgattacagcttagagctttgtggtggttgtcacgttgataatacagcttctatc
ggtattttcaaaatcgttgctgagtctggtatcggtgcaggaactcgtcgtattgaagca
gtaactggtaagtctgcatacgaattaatgaacgatcaagtaggtttattaaaagaagca
gcaggaaaaatgaaaacaaatccgaaagatatcttaacaagagttgatggtctatttgct
gaagtaaaacaacttcaaaaagaaaacgaatctcttgctgcgaaattaagcaatatcgaa
gctggaaacttaactgattctgtaatgacagttgatggcgtaaatgtattagcagcgaaa
gtaaatgttgcagatatgaataacttacgtacgatgatggatgatctaaaaaataaatta
gagtcagcagttgttgtattagcgtctgttaatgacgataaagtaaacatcctagcaggt
gtaacgaaagacttaattggccaaggttaccatgctggtaaacttgtgaaagaagtagct
tctcgttgcggcggtggcggtggtggccgtcctgatatggcacaagcaggcggtaaaaac
ccagctcaagtcgaagaagctttagcatttgtacaagagtacgttaaatctgtttcaaaa
taa

DBGET integrated database retrieval system