KEGG   Bacillus thuringiensis Bt407: BTB_c45290Help
Entry
BTB_c45290        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: bPH_3 GRAM Imm26
Motif
Other DBs
NCBI-ProteinID: AFV20210
Position
4385521..4385865
Genome map
AA seq 114 aa AA seqDB search
MTTLLNKAKNILATDETILFYAACSLDIFIYRSVARPGLLILTNKRLFFYGPDVSKNPIF
EEYSFAKISNLKEQKRLFNNQIVFMYDNEWKKIKHIQTNDVNSLVQKIHEQLSK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttacttaacaaagctaaaaacatattagcgactgacgaaacgatattattt
tacgcagcatgttcattagacatatttatttatcgttccgtcgcaaggccaggattgcta
attttaacgaacaaaaggctattcttttacgggccagatgtaagtaagaatccaatattt
gaagagtactctttcgcaaaaatttctaatctaaaagaacaaaagcgtcttttcaacaat
caaattgtatttatgtatgataacgaatggaaaaaaataaaacatattcaaacaaatgat
gtgaactctctcgttcaaaagatacacgagcagctttctaaataa

DBGET integrated database retrieval system