KEGG   Bacillus thuringiensis Bt407: BTB_c45300Help
Entry
BTB_c45300        CDS       T02277                                 

Gene name
yrrI
Definition
(GenBank) YrrI
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport OST3_OST6
Motif
Other DBs
NCBI-ProteinID: AFV20211
Position
complement(4385910..4386977)
Genome map
AA seq 355 aa AA seqDB search
MKNLKIIWIYRLGLLLLVFLCLLVFLKIKPLWAPIIFVFKVAITPFLIACFIAYLLHPLI
EKIHKEGMPRTLAILLIYILFFGGIGYGIYKGTPVVIKQLQEINEQFPQFTRMYDSWMDG
VTEQTANFPSFIHEKVKQLFVGVETKIQALLNKVMSTARGVLDSLLIIFLIPFIVFYILK
DYGEFYHIFWKLVPSKWRGTGQMLAKEIDKSLGSYIRGQLFVCLVLGGVSALSFWFIGMK
YPLLLGIIIGVTDIIPYFGPILGAIPTLMIAATVSTSLLIKAGITIAILQFVESNILSPY
IVGKSLRMHPVIIMLALLVGGEVAGIVGLLISVPILAVIRTVIVHVRPLLKKENV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatcttaaaatcatttggatatatcgtttaggattattgttacttgtttttctt
tgtttgctcgtctttttaaaaattaagccactatgggcaccgattatttttgtatttaaa
gtagcaattacgccgtttcttatcgcctgttttattgcgtatttattgcaccctttaatt
gaaaaaattcataaggaagggatgccccgtacacttgccattttgctcatttatatcctt
ttcttcggcggaattggttatgggatttataaaggaacaccagtcgttattaaacagtta
caagagattaatgaacaatttccgcagtttacaaggatgtacgattcgtggatggatggc
gttacagaacaaacagcgaatttcccttcgttcattcatgaaaaggtgaaacaacttttt
gtgggtgtggaaacgaagattcaagcgcttttaaataaagtgatgagtacagctcgtggt
gtactcgattcattgctcattattttcttaataccgttcattgtattttacatattaaaa
gattatggtgagttttatcatatcttttggaaactagtcccaagtaaatggcgaggtacg
gggcaaatgcttgcgaaagaaattgataagtcacttggaagttatattcgaggacagtta
tttgtttgtttagtattagggggagtatcagctctttctttttggtttatcggtatgaaa
tatccattattgcttggcattattattggggtaacggatataatcccgtactttggtcct
attttaggagcgatcccgacgttaatgattgcagcaacagtatcaacgagtttacttatt
aaggcggggattacgattgctattttgcaatttgtggaaagtaacattttatcgccttac
attgttggtaagtcacttcgtatgcatcctgttattattatgcttgcattactagttggg
ggggaagtagctggtattgtagggttactaatatcggttccgattttagcagttattcgt
actgtcattgttcatgtgagacctctcttgaaaaaagaaaatgtgtaa

DBGET integrated database retrieval system