KEGG   Bacillus thuringiensis Bt407: BTB_c45310Help
Entry
BTB_c45310        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFV20212
Position
4387154..4387366
Genome map
AA seq 70 aa AA seqDB search
MVLFMLGLSALFMILEWICIGFGIWKGFFIRSSRKEKAKQLWQYGILGVGCYGLSYFFSE
IGLFYLHMSA
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtttatgcttggattatcagcactttttatgattcttgaatggatttgtatc
ggctttggtatttggaaggggttctttattcgttcctcacgtaaagaaaaagcgaagcaa
ttatggcagtatggaatacttggcgttggctgttacggtctatcttattttttctcagaa
attggacttttttatttgcatatgagtgcataa

DBGET integrated database retrieval system