KEGG   Bacillus thuringiensis Bt407: BTB_c45380Help
Entry
BTB_c45380        CDS       T02277                                 

Gene name
cymR
Definition
(GenBank) HTH-type transcriptional regulator CymR
  KO
K17472  Rrf2 family transcriptional regulator, cysteine metabolism repressor
Organism
btg  Bacillus thuringiensis Bt407
Brite
Transcription factors [BR:btg03000]
 Prokaryotic Type
  Helix-turn-helix
   Rrf2 family
    BTB_c45380 (cymR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HrcA_DNA-bdg Rio2_N RuvB_C CBM39
Motif
Other DBs
NCBI-ProteinID: AFV20219
Position
complement(4393390..4393806)
Genome map
AA seq 138 aa AA seqDB search
MKISTKGRYGLTIMIDLAKKFGEGPISLKSIAQAHDLSEHYLEQLISPLRNARLVKSTRG
AYGGYVLSDQPANITAGDVIRVLEGPISVVEMIEEEEPAQRQLWMRVRDAVQEVLDSTTL
EDLVRYEEENHGGYMFYI
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttcaacaaaaggccgctatggcttaacaattatgattgatcttgcaaaaaag
tttggtgaaggtccaatttcattaaaatcaattgcgcaggcgcatgacttatccgagcat
tacttagagcaattaatttcaccacttcgtaacgctcgtcttgtaaagagtacgcgcggg
gcatatggcggatatgtattatctgatcaaccggctaacattacagctggggatgtaatc
cgtgtattagagggaccgattagtgttgtagaaatgatagaagaagaagagccagcacag
cgccagttatggatgcgtgttcgtgatgccgtgcaagaagtgttagatagtacaacgtta
gaagatttagtacgttatgaggaagaaaatcacgggggctatatgttttacatttaa

DBGET integrated database retrieval system