KEGG   Bacillus thuringiensis Bt407: BTB_c45390Help
Entry
BTB_c45390        CDS       T02277                                 

Gene name
yrvN
Definition
(GenBank) putative AAA domain-containing protein YrvN
  KO
K07478  
putative ATPase
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
4394100..4395386
Genome map
AA seq 428 aa AA seqDB search
MKQPLAHRMRPTNIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIA
GSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLL
TLIGATTSNPFHAINSAIRSRCQIFELHALTEDDILIGLKRALEDKEKGLGEYAVTVTDE
ALHHFANASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAH
YDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLA
AIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSH
YKGAESLGRGIGYLYPHDHPNGWVRQQYLPDKIKNKQYYKPKTTGKFEQALSTVYERLQT
SNKTKNKG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccactcgcacatcgaatgcgccctacaaatattcaagaaattattgggcaa
caacatttagttggtgaaggaaagattttatggcgaatggtccaagcaaatcattttcaa
tctatgattttatacggtcctccaggtacaggaaaaacatccattgccagtgcaattgca
ggaagtaccggtaccccgtttcgtctattaaacgctgttactcacaataaaaaagatatg
gaagttgtcgtacaagaagcaaagatgcatcgacacctcgttttaattttagatgaagtt
caccgtctagataaagcaaagcaagactttctattacctcacttagaaagcggacttctt
actttaattggtgcaacgacaagtaatccattccatgcaataaactccgctattcgaagc
aggtgtcaaattttcgaattacacgcactaacagaagatgatattttaattgggttaaaa
agagctttagaagataaagaaaaaggccttggagaatatgctgtaacggtaacagatgaa
gcactacatcattttgcaaatgcctctggtggtgatatgcgttccgcttataacgcactt
gaacttgctgtattatctagctttactacagacgatcaagcggctgaaatcacactcgag
attgcagaagaatgcttacaaaagaagagcttcgttcacgacaaaggcggcgatgctcat
tatgacgtattatcagcatttcaaaaatcagtacgcggaagtgatgtaaatgcagcgctc
cattatttagcacgccttattgaagcaggtgatttacaaagtattggcagacgccttctt
attatggcttatgaagatattggacttgctagcccacaagctggaccgcgtacactagct
gcaattgaatcagctgaacgagttggattcccagaagcacgcatcccacttgcaaatgcc
gttatagagctatgcttatcaccaaaatcaaattcagcttataaagcacttgatgctgca
ttacacgatttacgcaacggtcaaacaggtgacattccaagccatttaaaagatagtcat
tacaaaggcgcagaatcactcggaagaggcattggatatttatatccacacgaccatcca
aatggctgggtaaggcaacaatacttacctgataaaataaaaaacaagcaatattataaa
ccgaaaacgacagggaaatttgagcaagcactttctactgtttatgaaagattacaaact
tcgaataaaacgaaaaataaagggtaa

DBGET integrated database retrieval system