KEGG   Bacillus thuringiensis Bt407: BTB_c45400Help
Entry
BTB_c45400        CDS       T02277                                 

Gene name
rsfA1
Definition
(GenBank) prespore-specific transcriptional regulator RsfA
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Myb_DNA-bind_6 DUF3847 Rootletin Myb_DNA-binding APG6 DUF4763 CDC73_C Cep57_CLD_2 DivIC
Motif
Other DBs
NCBI-ProteinID: AFV20221
Position
4395424..4396065
Genome map
AA seq 213 aa AA seqDB search
MKTRQDAWTKEDDLLLAETVLRHIRSGSTQIKAFDEVGDALNRTSAACGFRWNAEVRPNY
EDAVQLAKKQRKELKRSEANIEKDRFTKTKQLVIDADFSEDITPSKQDLTMQNVISFLQN
LEHNNPSLAKLQTENDVLQAQLTSLQKTNHELETKLAVLTKKQQAIEEDYAMLVRIMDRA
RKLVSVEEQEEHIAPIFKTDQNGNLDIIYSAEN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtcaagatgcatggacaaaagaagatgatctccttttagcagaaactgtt
ttgcgacatattcgcagcggaagtacacaaataaaagcgtttgatgaagttggcgacgct
ttaaaccgcacttccgcagcttgtggttttagatggaatgctgaagtaagaccgaattac
gaagatgcggtgcagcttgcaaaaaaacaacgtaaagaattaaaacgttctgaagctaat
atagaaaaagatcggttcacgaaaacgaaacaactcgtaattgacgccgatttttcagaa
gatattacgccaagtaaacaagatcttacaatgcaaaatgtcatctcatttttacaaaat
ttagaacataacaatccttcacttgcaaagttgcaaactgaaaatgatgtattacaagct
cagctcacttctctgcaaaaaacgaatcatgaacttgaaacgaaattagcggtactcaca
aaaaaacaacaagcaatcgaagaagattacgcgatgcttgttcgaattatggatcgcgct
cgaaaacttgtttcggttgaagaacaagaagaacatattgctcccattttcaaaacagat
caaaatggaaatttagatattatatattctgcagagaattaa

DBGET integrated database retrieval system