KEGG   Bacillus thuringiensis Bt407: BTB_c45440Help
Entry
BTB_c45440        CDS       T02277                                 

Definition
(GenBank) hypothetical protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mga Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: AFV20225
Position
complement(4401065..4401241)
Genome map
AA seq 58 aa AA seqDB search
MRMNEKGHSVTNGANQLFNVNFHDFISKEQNNTSMELASEFGISLQDVKRLKKQIERS
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatgaatgaaaaagggcattctgttacaaatggtgcaaatcaactgtttaacgtg
aattttcatgattttatttcaaaagagcaaaataatacttcaatggagcttgcttccgag
tttgggatttctcttcaagatgtaaagcgtttaaagaagcagattgaacgttcttag

DBGET integrated database retrieval system