KEGG   Bacillus thuringiensis Bt407: BTB_c45490Help
Entry
BTB_c45490        CDS       T02277                                 

Definition
(GenBank) cation efflux family protein
Organism
btg  Bacillus thuringiensis Bt407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer CD99L2 DUF4043 TctB
Motif
Other DBs
NCBI-ProteinID: AFV20230
Position
complement(4407259..4408152)
Genome map
AA seq 297 aa AA seqDB search
MEKDERFKQAEFGAIVGIVGNIILAIVKAVIGYIGNSKALLADAVHSASDVIGSLAVLFG
LRAAKQPPDEDHPYGHGKAESISAIIVAVLLFIVGLEIAISSIKAFSQELEPPKGITIFA
VVLSIVVKEGMFQYKFRLGKRVNSDAIIANAYEHRSDVFSSIAALIGICAAILGGKLGID
WLVYADPIAGLVVSLLVVKMAWSIGAEAIHATLDHVLHEEDVIPLREAVLQVDGVKKIGS
LYAREHGHYVIVDIKVSVDPYITVEEGHRIGKHVKEILMKQDNVQNVFVHINPYSPN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagatgaacgttttaaacaggccgagtttggtgctattgtcgggatcgttggt
aatattatattagcaattgtaaaggcggtaattggttatattgggaacagtaaagcactg
ctagcagatgcggtgcattctgcatcagatgtaattggttcgctagctgtactttttgga
ttgcgagcggcaaagcagccacctgatgaagatcatccgtatggtcatggtaaagcggaa
tcgatttcagcgattattgttgcggtattattatttattgtgggacttgaaatcgcgatt
tcatctataaaagctttttcgcaagaactagaaccgccgaaaggaattacgatttttgct
gttgttctttcaatcgtcgtgaaagaaggaatgtttcaatataaattccgattagggaaa
agggtaaatagtgatgcaattattgcaaatgcatatgagcaccgttcggatgtattttct
tcaattgcagctttaatcggtatttgtgcagctatactcggtggtaagcttggtatagac
tggcttgtatatgctgatccgattgcaggattagttgtttcgcttcttgttgtaaaaatg
gcatggagcattggagcggaagcaattcatgcaacgcttgaccatgttcttcatgaggag
gatgttattccgcttagagaagcagtccttcaagtagatggtgtgaaaaaaattggttct
ttatatgcacgggagcatggtcattatgttattgtcgatattaaagtgtctgtagatcca
tacattactgtagaagaaggacaccgtattggaaaacatgtgaaagaaatacttatgaaa
caagataatgtacaaaatgtattcgtacatataaatccgtattctccaaattaa

DBGET integrated database retrieval system