KEGG   Bacillus thuringiensis Bt407: BTB_c48580Help
Entry
BTB_c48580        CDS       T02277                                 

Gene name
ytjP
Definition
putative dipeptidase YtjP (EC:3.4.13.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTB_c48580 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BTB_c48580 (ytjP)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BTB_c48580 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4697738..4699144)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGTPFGEGVEKALSFMLHKGEAE
GFASKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGKSTIEGNTVTLQIEGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDIFGEKATIAYKDEISGPLTVNVGRLSYKKENGGNLGLNVRYPVTTNFEE
MIAKLKEYVGTYGFAVADYSNSRPHHVDKDHELIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgattaattggactgaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagaaggcaca
ccattcggtgaaggtgtagaaaaagcgctatctttcatgttacataaaggagaagctgaa
ggttttgcttctaaaaatttagaaggatatgcaggtcatcttgaaatgggacaaggagaa
gagttagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cctgcgtatagtgcggatattcgcgacggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttcaaaacgtgttcgtatgattataggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcaccagatgcagacttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgtcgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaatagggaaatcgactatagaaggcaatacagta
acgttgcaaatagaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttaactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatatttttggtgaaaaagctactattgct
tataaagatgaaattagcggtccattaacagtgaatgttggtcgcctttcttataagaaa
gagaatggtggtaatttaggattaaacgtacgttacccagttacgactaactttgaagaa
atgattgcaaagttaaaagaatatgtaggtacgtatggatttgcagtagcagactattct
aactctcgtccgcatcacgttgataaagatcacgagttaattcgtacgttgcaacgtgta
tatgaggaacaaacaggtgaaaaagctgaattgttagcaatcggcggaggtacttatgct
cgctcattaaaagctggtgtggcatttggaccgctattccctggaaaagaagaacttgcg
catcaaaaagatgagtacattgaaattgaagacttattaaaagcaacagcaatttatgcg
caagcaattcatgaactagcgaagtaa

DBGET integrated database retrieval system