KEGG   Bacillus thuringiensis Bt407: BTB_c49120Help
Entry
BTB_c49120        CDS       T02277                                 

Gene name
ytpA
Definition
phospholipase YtpA (EC:3.1.1.-)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BTB_c49120 (ytpA)
Enzymes [BR:btg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BTB_c49120 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4748603..4749406)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVEGIILSSPCLGVVT
GPSAPLQFASKILNVVAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILSYIQSFTEMHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcagaggaagcgaaagctgtcattgttattgtgcacggcgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaagcaagaaagtataggtta
cctatttttttattcggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagagggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgcttcaaaaatattaaatgttgtggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacacgtaaccatgaagtgagagatgca
atggagaatgattctttgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagatgattttccagatgttccgctcttgcta
atgcaagcttgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgagttatattcagtcatttactgaaatgcatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system