KEGG   Bacillus thuringiensis Bt407: BTB_c50820Help
Entry
BTB_c50820        CDS       T02277                                 

Gene name
gtaB1
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase GtaB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00040  Pentose and glucuronate interconversions
btg00052  Galactose metabolism
btg00500  Starch and sucrose metabolism
btg00520  Amino sugar and nucleotide sugar metabolism
btg01100  Metabolic pathways
btg01130  Biosynthesis of antibiotics
Module
btg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTB_c50820 (gtaB1)
   00052 Galactose metabolism
    BTB_c50820 (gtaB1)
   00500 Starch and sucrose metabolism
    BTB_c50820 (gtaB1)
   00520 Amino sugar and nucleotide sugar metabolism
    BTB_c50820 (gtaB1)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BTB_c50820 (gtaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFV20736
Position
complement(4895128..4896015)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQEG
RRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILEEQVNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gcaacgaaagcaatgccgaaagaaatgttaccaatagtagataaaccaacgatccaatac
attgtagaagaagcagtgaaatcgggtatcgaagatattattatcgttactggtaaaaca
aagcgttctattgaagatcattttgataatgcatttgaactagaacaaaacttattagag
aagaaaaaatatgagttgcttgaaaaagtacaagcctcttcaaaaatggtagatattcat
tatatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcgcgtaaattc
attggtgatgagccgtttgcagtgttactaggtgatgatattgtccaagctgagaaaccg
tgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgtacaa
actgttccagagtcggaaacacatcgctatggaattatcgatccattagaacaagaaggt
cgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagctccttcaaac
ttagccattatgggccgttacattttaacgcctgaaatctttatgttcttagaacagcaa
catgtcggtgctggtggtgaaattcaattaacagatgcaatccaaagcttaaatgaaatc
caacgtgtatttgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaattgaaatggccctgcaacacccagaattacgtgatgacatggtc
gtaatgatgaagaaaattttagaagaacaagtgaatcaagagtcttaa

DBGET integrated database retrieval system