KEGG   Bacillus thuringiensis Bt407: BTB_c50820Help
Entry
BTB_c50820        CDS       T02277                                 

Gene name
gtaB1
Definition
UTP--glucose-1-phosphate uridylyltransferase GtaB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTB_c50820 (gtaB1)
   00052 Galactose metabolism
    BTB_c50820 (gtaB1)
   00500 Starch and sucrose metabolism
    BTB_c50820 (gtaB1)
   00520 Amino sugar and nucleotide sugar metabolism
    BTB_c50820 (gtaB1)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BTB_c50820 (gtaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4895128..4896015)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQEG
RRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVVMMKKILEEQVNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gcaacgaaagcaatgccgaaagaaatgttaccaatagtagataaaccaacgatccaatac
attgtagaagaagcagtgaaatcgggtatcgaagatattattatcgttactggtaaaaca
aagcgttctattgaagatcattttgataatgcatttgaactagaacaaaacttattagag
aagaaaaaatatgagttgcttgaaaaagtacaagcctcttcaaaaatggtagatattcat
tatatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcgcgtaaattc
attggtgatgagccgtttgcagtgttactaggtgatgatattgtccaagctgagaaaccg
tgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgtacaa
actgttccagagtcggaaacacatcgctatggaattatcgatccattagaacaagaaggt
cgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagctccttcaaac
ttagccattatgggccgttacattttaacgcctgaaatctttatgttcttagaacagcaa
catgtcggtgctggtggtgaaattcaattaacagatgcaatccaaagcttaaatgaaatc
caacgtgtatttgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaattgaaatggccctgcaacacccagaattacgtgatgacatggtc
gtaatgatgaagaaaattttagaagaacaagtgaatcaagagtcttaa

DBGET integrated database retrieval system