KEGG   Bacillus thuringiensis Bt407: BTB_c53280Help
Entry
BTB_c53280        CDS       T02277                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00010  Glycolysis / Gluconeogenesis
btg00051  Fructose and mannose metabolism
btg00562  Inositol phosphate metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01120  Microbial metabolism in diverse environments
btg01130  Biosynthesis of antibiotics
btg01200  Carbon metabolism
btg01230  Biosynthesis of amino acids
Module
btg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btg_M00002  Glycolysis, core module involving three-carbon compounds
btg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTB_c53280 (tpiA)
   00051 Fructose and mannose metabolism
    BTB_c53280 (tpiA)
   00562 Inositol phosphate metabolism
    BTB_c53280 (tpiA)
Enzymes [BR:btg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BTB_c53280 (tpiA)
Exosome [BR:btg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BTB_c53280 (tpiA)
  Exosomal proteins of bladder cancer cells
   BTB_c53280 (tpiA)
  Exosomal proteins of melanoma cells
   BTB_c53280 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFV20979
Position
complement(5119202..5119957)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcaactgaaggaactgacttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagttggctatgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagacgaatcagtaaacaaaaagactatcgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagacgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtatccaatacggcggtagcgtaaaaccagaaaacattaaa
gagtatatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system