KEGG   Bacillus thuringiensis Bt407: BTB_c55700Help
Entry
BTB_c55700        CDS       T02277                                 

Gene name
speB
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:btg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5375529..5376401)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESKVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDADKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcaaaggtagttatttatgggatgcctatggattggacagtaagttaccgtccagga
tctcgttttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagtccg
tatttagatcgtgaattagaagaggtaaaatattttgatgcgggtgatatcccattacca
ttcggaaacgcacaacgcagcttagacatgattgaagagtatgtatcaaaacttttagat
gccgataagtttccactaggtctcggcggtgagcacctagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccacatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacaccaattcgtaaagtgtgtgat
ttaattggtccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcgaaagaagtaggtatgaacttatataaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgctggacgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggtggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagactta
gtagaagtagccccagtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtaaaataa

DBGET integrated database retrieval system