KEGG   Bacteroides thetaiotaomicron: BT_0311Help
Entry
BT_0311           CDS       T00122                                 

Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bth01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bth00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bth00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373622..374992
Genome map
AA seq 456 aa AA seqDB search
MSRFEIKMPKLGESITEGTIVSWSVKVGDVIQEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVAVGTVVAVVDMGGEEASDEETASGKETPESKENASSDAEKVSSQVAKAEERW
YSPVVIQLARGANIPKEELDSIQGTGYEGRLSKKDIKDYIEKKKRGISEVSKAAIPTGDA
LTASMPSSTGGAGSMTTSPVAASVQTPVAAPSAPSKQAPAAANIPGVEVKEMDRVRRIIA
DHMVMSKKVSPHVTNVVEVDVTKLVRWREKNKDAFFRREGVKLTYMPVITEAVAKALAAY
PQVNVSVDGYNILFKKHINIGIAVSLNDGNLIVPVVHDADHLNLNGLAVAIDSLALKARD
NKLMPDDIDGGTFTITNFGTFKSLFGTPVINQPQVAILGVGYIEKKPAVIETPEGDTIAI
RHKMYLSLSYDHRVVDGMLGGNFLHFIADYLENWKG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagattcgaaataaaaatgcctaagttgggcgagagtataaccgaagggacgatt
gtctcttggtctgtgaaagtgggggatgtcattcaggaagacgatgttctcttcgaggta
aatacggcgaaagtcagtgcggaaataccttcaccggtagctggtaaggtagtggaaatt
ctgtttaaggaaggagatacagtcgctgtaggtacagtggttgctgttgtagatatggga
ggtgaagaggcatccgatgaagaaactgcaagtggaaaagaaactccagaaagtaaggag
aatgcttcttctgatgcagaaaaagtatcttctcaggtagcaaaggctgaggaacgctgg
tattctcctgtggtgattcaattggcacgaggtgcaaatattccgaaagaagaacttgat
tcgatacaaggcacaggatacgaaggccggttaagcaagaaagatataaaggattatatt
gagaagaagaaaaggggaatttccgaagtctcgaaggcggcgatacctaccggtgatgca
cttacggcttctatgccttcttcgactggaggggctggctctatgacaacttctcctgtg
gcggcttccgtgcaaactcctgttgctgcaccgtctgctccatctaaacaagcacctgca
gctgctaatattccgggagtagaagtgaaagaaatggatcgtgtccgccggattattgcg
gatcatatggtgatgtccaagaaggtttcaccacacgtaaccaatgtagtagaggtagac
gtaaccaaactggtacgctggcgtgaaaagaataaagacgctttcttccgccgtgaggga
gtgaaactgacctatatgcctgtcataacagaagctgttgcaaaagcattggcagcatat
cctcaggtcaatgtatctgttgacggatataatattcttttcaagaaacatatcaatatc
ggtattgctgtttctttgaatgatggcaatctgatagttcctgtggtacacgatgccgat
catctgaacttgaatggattggctgtagctatagactcgctggcattgaaggctcgtgat
aacaaattgatgccagatgatattgacggaggtacgtttaccattactaatttcggtaca
ttcaagagtttgttcggtacgccggtgatcaatcagccccaggttgccattttgggagtg
ggatatattgagaagaagcctgccgtaatagagacaccggaaggtgatacgattgctatc
cgtcataagatgtatctgtccctgtcttatgaccatcgtgtagttgacggtatgctggga
ggcaacttcctgcacttcatagccgattacctggaaaactggaagggctga

DBGET integrated database retrieval system