KEGG   Bacteroides thetaiotaomicron: BT_0311Help
Entry
BT_0311           CDS       T00122                                 

Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT_0311
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BT_0311
  Amino acid metabolism
   00310 Lysine degradation
    BT_0311
Enzymes [BR:bth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BT_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373622..374992
Genome map
AA seq 456 aa AA seqDB search
MSRFEIKMPKLGESITEGTIVSWSVKVGDVIQEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVAVGTVVAVVDMGGEEASDEETASGKETPESKENASSDAEKVSSQVAKAEERW
YSPVVIQLARGANIPKEELDSIQGTGYEGRLSKKDIKDYIEKKKRGISEVSKAAIPTGDA
LTASMPSSTGGAGSMTTSPVAASVQTPVAAPSAPSKQAPAAANIPGVEVKEMDRVRRIIA
DHMVMSKKVSPHVTNVVEVDVTKLVRWREKNKDAFFRREGVKLTYMPVITEAVAKALAAY
PQVNVSVDGYNILFKKHINIGIAVSLNDGNLIVPVVHDADHLNLNGLAVAIDSLALKARD
NKLMPDDIDGGTFTITNFGTFKSLFGTPVINQPQVAILGVGYIEKKPAVIETPEGDTIAI
RHKMYLSLSYDHRVVDGMLGGNFLHFIADYLENWKG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagattcgaaataaaaatgcctaagttgggcgagagtataaccgaagggacgatt
gtctcttggtctgtgaaagtgggggatgtcattcaggaagacgatgttctcttcgaggta
aatacggcgaaagtcagtgcggaaataccttcaccggtagctggtaaggtagtggaaatt
ctgtttaaggaaggagatacagtcgctgtaggtacagtggttgctgttgtagatatggga
ggtgaagaggcatccgatgaagaaactgcaagtggaaaagaaactccagaaagtaaggag
aatgcttcttctgatgcagaaaaagtatcttctcaggtagcaaaggctgaggaacgctgg
tattctcctgtggtgattcaattggcacgaggtgcaaatattccgaaagaagaacttgat
tcgatacaaggcacaggatacgaaggccggttaagcaagaaagatataaaggattatatt
gagaagaagaaaaggggaatttccgaagtctcgaaggcggcgatacctaccggtgatgca
cttacggcttctatgccttcttcgactggaggggctggctctatgacaacttctcctgtg
gcggcttccgtgcaaactcctgttgctgcaccgtctgctccatctaaacaagcacctgca
gctgctaatattccgggagtagaagtgaaagaaatggatcgtgtccgccggattattgcg
gatcatatggtgatgtccaagaaggtttcaccacacgtaaccaatgtagtagaggtagac
gtaaccaaactggtacgctggcgtgaaaagaataaagacgctttcttccgccgtgaggga
gtgaaactgacctatatgcctgtcataacagaagctgttgcaaaagcattggcagcatat
cctcaggtcaatgtatctgttgacggatataatattcttttcaagaaacatatcaatatc
ggtattgctgtttctttgaatgatggcaatctgatagttcctgtggtacacgatgccgat
catctgaacttgaatggattggctgtagctatagactcgctggcattgaaggctcgtgat
aacaaattgatgccagatgatattgacggaggtacgtttaccattactaatttcggtaca
ttcaagagtttgttcggtacgccggtgatcaatcagccccaggttgccattttgggagtg
ggatatattgagaagaagcctgccgtaatagagacaccggaaggtgatacgattgctatc
cgtcataagatgtatctgtccctgtcttatgaccatcgtgtagttgacggtatgctggga
ggcaacttcctgcacttcatagccgattacctggaaaactggaagggctga

DBGET integrated database retrieval system