KEGG   Bacteroides thetaiotaomicron: BT_0411Help
Entry
BT_0411           CDS       T00122                                 

Definition
CysQ, sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BT_0411
Enzymes [BR:bth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BT_0411
Transfer RNA biogenesis [BR:bth03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BT_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
497130..497936
Genome map
AA seq 268 aa AA seqDB search
MAAIDAALKAGEKILSIYEDPKSDFEIERKADNSPLTIADRKAHEAIVAILNETPFPVLS
EEGKHMDYAVRRGWDTLWIVDPLDGTKEFIKRNGEFTVNIALVQNAVPVMGVIYVPVKKE
LYFAVEGTGAYKCSGIVGLEDEGVTLQQMIEKSERMPLADARDHFIAVASRSHLTPETET
YIADLKKKHGNVELISSGSSIKICLVAEGKADVYPRFAPTMEWDTAAGHAIARAAGMEVY
QAGKEEPLRYNKEDLLNPWFIVEAKRER
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctgctatcgatgcagcgttgaaagcgggtgaaaaaatcctttctatctatgaagat
ccgaagtcggattttgaaatagagaggaaggcggataactctcccttaacgatagcagac
aggaaagcccacgaggcgattgtggccattttgaatgaaactccttttccggttcttagt
gaagaaggaaagcatatggactatgcagtgcggcgaggctgggatactttatggattgta
gacccgctggacggaacgaaggagttcatcaagcgtaacggagaatttacggtaaatata
gctttggtgcagaacgctgtacctgtaatgggtgttatttacgtgcctgtaaaaaaagaa
ctttattttgcagtggaggggacaggtgcctataagtgttccggcattgtcggtctggaa
gacgagggagtgaccttacagcagatgattgagaaatcggaacggatgccattggcggat
gcgcgcgaccattttattgctgtcgcttcccgttcacacctgacgcctgaaactgaaaca
tatattgcagacttaaaaaagaaacacggcaatgtggaactgatatcaagcggaagttcc
attaaaatctgtctggttgccgaaggaaaggcggatgtctatccgcgttttgctccgacg
atggaatgggatacggctgccggacatgcgatagcccgtgccgcagggatggaagtatat
caggcagggaaggaggaacctttgcgatataacaaagaggatctgctgaatccgtggttt
atcgttgaagcaaaaagagaacgctaa

DBGET integrated database retrieval system