KEGG   Bacteroides thetaiotaomicron: BT_0459Help
Entry
BT_0459           CDS       T00122                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bth00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bth00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565899..568223
Genome map
AA seq 774 aa AA seqDB search
MKQLLKLTGCVALAGLMSSCGSVQEEANYQIIPLPQEIVTSQVNPFILKSGVKILYPEGN
EKMQRNAQFLADYLKTATGKDFSIEAGTEGKNAIVLALGSEVENPESYQLKVTDQGVTIT
APTEAGVFYGIQTLRKSLPIALGADVALPAVEIKDAPRFGYRGAHFDVSRHFFTIDEVKT
YIDMLALHNMNRLHWHITDDQGWRLEIKKYPKLTEIGSQRSGTVIGRNSGEYDNTPYGGF
YTQEQAKEIVDYAAERYITVVPEIDLPGHMLAALAAYPELGCTGGPYEVWRQWGVADDVL
CAGNDQVLKFLEDVYGELIEIFPSEYIHVGGDECPKVRWEKCPKCQARIKALGLKSDKNH
SKEERLQSFVINHIEKFLNDHGRQIIGWDEILEGGLAPNATVMSWRGESGGIEAAKQKHD
VIMTPNTYLYFDYYQAKDTENEPFGIGGYLPMERVYSYEPMPASLTPDEQQYIKGVQANL
WTEYIATFSHAQYMVLPRWAALCEVQWSTPDKKNYEDFLSRLPRLIKWYDAEGYNYAKHV
FDVKAEFTPNPADGTLDITLTTIDNAPIHYTLDGTEPTSTSPVYDGALKIKENADFSAIA
IRPTGNSRVVSEKIDFSKSSMKPIVANQPVNKQYEFKGVSTLVDGLKGNGNYKTGRWIAF
RGNDMDVTIDLKQPTEISSVAISTCVEKGDWVFDTRGLSVEVSEDGTNFTKVASEAYPAM
KETDKNGVYDHKLTFTPVTAQYVKVIASPEKSIPEWHGGKSYPGFLFVDEITIN
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaactcctaaaattaacaggatgtgtggcactggcaggactgatgagctcttgt
ggctcggtacaagaagaagccaattatcagattatcccattgccacaagaaattgtaaca
tcgcaagtaaacccctttattttgaaaagcggtgtgaaaatcctttatccggaaggaaat
gagaagatgcagcgtaatgcgcaatttttggctgattatctgaagactgcaaccggaaaa
gacttttcgattgaagccggaactgaaggtaaaaatgctatagtgctggcgttaggctca
gaagtagaaaaccctgaatcttatcagttgaaagtcaccgatcaaggtgtcacgataact
gcccctacagaagccggagttttctatggtattcagactttgcgtaaatcattgcctatt
gctttgggtgctgatgtagcattgcctgctgttgaaattaaggatgctcctcgtttcggt
tatcgtggtgcacatttcgatgttagtcgtcatttcttcacaattgatgaagtgaagact
tatattgatatgctggctttgcacaacatgaaccgtttgcactggcatatcactgacgat
cagggatggcgtctggaaatcaagaaatatccgaagttgacggaaataggttctcaaaga
tcgggaacggtcatcggacgtaactccggtgaatatgacaatacaccctatggtggattc
tatacacaggaacaggctaaggaaattgtagattatgccgcagaacgttatatcactgtt
gttcctgagattgaccttccgggacacatgctggctgcccttgccgcttatccggaattg
ggttgtaccggtggaccgtatgaagtttggagacaatggggagtagccgatgatgtactt
tgtgccggcaacgatcaggttctgaaattcctggaagatgtatatggcgaattgattgaa
atcttcccttcagagtatatccatgtaggtggtgacgaatgtccgaaggtaagatgggag
aaatgtccgaaatgtcaggcacgtatcaaagcgttgggcttgaaatcggataagaatcat
agtaaggaagaacgtttgcagagtttcgttatcaatcatatagagaagttcctgaacgat
cacggacgtcagattatcggttgggatgagattctcgaaggcggacttgctcctaatgca
acagttatgtcatggcgtggcgaaagtggaggtattgaagctgccaagcagaaacatgat
gtgatcatgaccccgaacacttatctgtattttgattattatcaggctaaagatactgag
aatgaacctttcggtatcggaggttatttgccgatggaaagggtgtacagctatgagccg
atgccggcttcccttactccggatgaacagcagtatataaaaggtgtacaggctaatctc
tggacagaatatattgctactttctctcatgctcaatatatggtcttgcctcgttgggct
gctttgtgtgaagtccagtggtcaacacctgataagaagaactacgaagatttcttatct
cgtcttccacgactgattaagtggtatgatgcagaaggatataattatgcaaagcacgta
tttgacgtaaaagcagaatttactccgaatccggctgatggtactttagacattacactt
actacaattgacaatgcgccaatccactacacgctagatggtacagagccgactagtact
tctcccgtttatgatggcgctttgaagattaaggaaaatgcagacttctcggctatagct
attcgccctactggaaatagtcgtgtcgtttctgagaaaatcgatttcagtaaatcaagc
atgaagccgattgttgctaatcagccggtgaataaacaatatgagttcaaaggtgtctct
acgttggtagatggcttgaaaggaaatggtaactataaaaccggacgctggattgcattt
agaggaaatgatatggatgtgactattgatctcaaacaaccaacagagatttcaagcgtt
gccatttctacttgcgtagagaagggagattgggtttttgatacaaggggactctctgta
gaagtttcagaagacggcacaaacttcacgaaagtggcatctgaagcttatcctgcaatg
aaggaaactgataaaaatggtgtttatgaccataaactaacatttacacctgtaactgca
caatatgtgaaagttatagcttcacccgagaaaagtattccggaatggcatggtggtaag
agttatccaggctttttatttgtagacgaaatcacaattaattaa

DBGET integrated database retrieval system