KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_0461Help
Entry
BT_0461           CDS       T00122                                 

Definition
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00052  Galactose metabolism
bth00511  Other glycan degradation
bth00600  Sphingolipid metabolism
bth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BT_0461
  Lipid metabolism
   00600 Sphingolipid metabolism
    BT_0461
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BT_0461
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BT_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 DUF3344 Glyco_hydro_42 Imm72 Invasin_D3
Motif
Other DBs
NCBI-GeneID: 1071772
NCBI-ProteinID: NP_809374
UniProt: Q8AAK3
Position
570314..572833
Genome map
AA seq 839 aa AA seqDB search
MTINIRYLLGIALLFSFSVISAQVRTSYTFEKGWKFTREDNADFIQPDYNDIKWQSVVVP
HDWAIYGPFGIDNDRQLTAIAQDGQKEAMEHAGRTGGLPFVGVGWYRLNFDAPSFVKGKK
ATLIFDGAMSHARVYINGQEAGYWPYGYNTFYLDVTPYLKEGTKNTLAVRLENETESSRW
YPGAGLYRNVHLVVTEDAHIPTWGTQLTTPVVKDDYAKVNIKTTLVVPSGKQFDAYRIVT
ELKDKDGKVVTTDEKQGSRFDDNIFSQELVVSRPALWSPETPVLYQAVSKVYEGNILKDE
YTTSFGIRTIEVIPNKGFFLNGKRTSFKGVCNHHDLGPLGGAVNDAAIRRQIRILKDMGC
NAIRTSHNMPAPELIRACDEMGMMVMAESFDEWKAMKVKNGYRHVFDEWAVKDLTNLLRH
YRNNPSVVMWCIGNEVPEQWDGNKGPKMSYFLQELCHREDPTRPVTQGMDAPDAVVNNNM
AAVMDIAGFNYRPHKYQENYKKLPQQIVLGSETASTVSSRGVYKFPVTRQWMKKYDDHQS
SSYDVESCSWSNLPEDDFIQHEDLPYCIGEFVWTGFDYLGEPTPYYTDWPSHSSLFGIID
LAGLPKDRYYLYRSHWNKEQETLHILPHWNWEGREGEITPVFVYTNYPSAELFINGKSQG
KRTKDLSVTIDNSADSVSIMNLKRQSRYRLMWMDTKYEPGTVKVVAYDADGKAVAEKELH
TAGKPDHIELVADRNVIKADGKDLSFVTVRVVDRDGNLCPDASHEISFKVKGEGSYRAGA
NGNAASLESFQHPKMKVFSGMMTAIVSSTEQPGKITLEATGKGLKKGALIIESCQEAKK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgactataaatattagatacttattaggaatagccctccttttttctttctctgtgatc
agtgcacaagtacgaacctcgtatacttttgagaaagggtggaagtttacacgtgaagat
aatgctgattttattcagcctgactataatgatatcaagtggcaatctgtggtagtaccc
catgactgggctatttatggaccttttggtatagataatgacaggcaattgacagccatt
gcgcaagacggacaaaaagaagcgatggaacatgccggacgtacaggtggtcttcctttc
gtcggagtgggttggtatcggctgaattttgatgctccctcttttgtcaaagggaaaaag
gctacattaatttttgacggagctatgagccatgctcgtgtgtatattaacggtcaggag
gctggttattggccttatggatacaataccttttatctggatgtaactccctatctgaaa
gaggggacaaagaatactttagctgttcgtttggagaatgagacagaatcttcccgttgg
tatccgggagccggactttacagaaatgtacatctggtagtaacggaagatgctcatatt
ccgacatggggtacacagttaactactccggtagtgaaggatgattatgcgaaagtgaat
ataaaaacgactttggtcgtaccttccggaaaacagtttgatgcataccgtatagtgact
gaacttaaagataaggatggaaaagtagtaactactgatgaaaaacaaggttcccgtttt
gatgataatatcttcagccaggaacttgttgtcagtcgtccggctttatggagcccggaa
actcctgttctttatcaggctgtctctaaagtctatgaaggcaatatactgaaggatgaa
tatacaacatctttcggtattcgtactattgaggtcattcccaataagggctttttctta
aatggaaagagaacttcattcaaaggcgtatgcaatcatcatgatctcggccccttggga
ggcgctgtgaatgatgctgctattcgtcgtcagattcgtattttgaaagatatgggttgt
aatgcgattcgtacttctcataatatgcctgctcctgagttaatcagagcttgtgatgag
atgggaatgatggtgatggcggaatcgtttgatgaatggaaggctatgaaggttaagaac
ggctatcgtcatgtttttgacgaatgggcagtaaaggatttgacgaacttgctacgtcat
tatcgtaataatccgagtgtggtgatgtggtgcatcggaaatgaggttcccgaacaatgg
gatggaaataaaggacctaaaatgtcttattttctacaggaactttgtcatcgtgaagat
ccgacacgtcctgtcacacaggggatggatgcgccggatgctgtagtcaataataatatg
gcggcagtaatggatattgcgggatttaattataggccacataaatatcaggagaattat
aaaaaacttcctcaacagatagtcttgggtagtgagactgcttctacggttagttcgcgt
ggagtatataaattccctgttacccggcaatggatgaagaaatatgatgatcaccagtct
tcttcttatgatgtggagtcttgttcatggtccaatctgcctgaggatgattttattcag
catgaggacttaccttattgcataggagagtttgtttggacaggattcgattatctgggt
gaaccgactccctattatacagattggcccagtcattcttcactatttggaattatcgat
ttagcagggctgcccaaagaccgttattatctctatcgtagtcactggaataaagaacag
gaaacacttcacattcttcctcactggaattgggaaggacgagagggagagataactcct
gtctttgtatataccaactatccttcagccgaattattcatcaacggaaagagccaaggg
aaacgtaccaaagacctttccgtaaccattgataacagtgctgactctgtttccatcatg
aacctgaagcgtcagagccgttaccgcctgatgtggatggatacaaaatatgagccgggt
acggtgaaagtcgtggcttatgatgctgacgggaaagctgtagctgaaaaagaactccat
acagccggtaaaccggatcatattgaattggtagccgatcgtaatgtaatcaaagcggat
ggaaaagatttatcttttgtgacagtgcgagtggtagatagagacggtaatctgtgtccg
gatgcctcacatgaaatcagtttcaaagtgaagggagagggtagttaccgtgcaggagct
aatggtaatgcagcttccttggaatctttccagcatccgaagatgaaagtcttcagcggt
atgatgactgctattgtatcttcgacagagcaaccgggcaaaataacccttgaagctacg
ggcaaaggcttgaaaaaaggagccttgatcattgaaagctgtcaggaagctaagaagtaa

DBGET integrated database retrieval system