KEGG   Bacteroides thetaiotaomicron: BT_0461Help
Entry
BT_0461           CDS       T00122                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bth00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bth00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bth00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570314..572833
Genome map
AA seq 839 aa AA seqDB search
MTINIRYLLGIALLFSFSVISAQVRTSYTFEKGWKFTREDNADFIQPDYNDIKWQSVVVP
HDWAIYGPFGIDNDRQLTAIAQDGQKEAMEHAGRTGGLPFVGVGWYRLNFDAPSFVKGKK
ATLIFDGAMSHARVYINGQEAGYWPYGYNTFYLDVTPYLKEGTKNTLAVRLENETESSRW
YPGAGLYRNVHLVVTEDAHIPTWGTQLTTPVVKDDYAKVNIKTTLVVPSGKQFDAYRIVT
ELKDKDGKVVTTDEKQGSRFDDNIFSQELVVSRPALWSPETPVLYQAVSKVYEGNILKDE
YTTSFGIRTIEVIPNKGFFLNGKRTSFKGVCNHHDLGPLGGAVNDAAIRRQIRILKDMGC
NAIRTSHNMPAPELIRACDEMGMMVMAESFDEWKAMKVKNGYRHVFDEWAVKDLTNLLRH
YRNNPSVVMWCIGNEVPEQWDGNKGPKMSYFLQELCHREDPTRPVTQGMDAPDAVVNNNM
AAVMDIAGFNYRPHKYQENYKKLPQQIVLGSETASTVSSRGVYKFPVTRQWMKKYDDHQS
SSYDVESCSWSNLPEDDFIQHEDLPYCIGEFVWTGFDYLGEPTPYYTDWPSHSSLFGIID
LAGLPKDRYYLYRSHWNKEQETLHILPHWNWEGREGEITPVFVYTNYPSAELFINGKSQG
KRTKDLSVTIDNSADSVSIMNLKRQSRYRLMWMDTKYEPGTVKVVAYDADGKAVAEKELH
TAGKPDHIELVADRNVIKADGKDLSFVTVRVVDRDGNLCPDASHEISFKVKGEGSYRAGA
NGNAASLESFQHPKMKVFSGMMTAIVSSTEQPGKITLEATGKGLKKGALIIESCQEAKK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgactataaatattagatacttattaggaatagccctccttttttctttctctgtgatc
agtgcacaagtacgaacctcgtatacttttgagaaagggtggaagtttacacgtgaagat
aatgctgattttattcagcctgactataatgatatcaagtggcaatctgtggtagtaccc
catgactgggctatttatggaccttttggtatagataatgacaggcaattgacagccatt
gcgcaagacggacaaaaagaagcgatggaacatgccggacgtacaggtggtcttcctttc
gtcggagtgggttggtatcggctgaattttgatgctccctcttttgtcaaagggaaaaag
gctacattaatttttgacggagctatgagccatgctcgtgtgtatattaacggtcaggag
gctggttattggccttatggatacaataccttttatctggatgtaactccctatctgaaa
gaggggacaaagaatactttagctgttcgtttggagaatgagacagaatcttcccgttgg
tatccgggagccggactttacagaaatgtacatctggtagtaacggaagatgctcatatt
ccgacatggggtacacagttaactactccggtagtgaaggatgattatgcgaaagtgaat
ataaaaacgactttggtcgtaccttccggaaaacagtttgatgcataccgtatagtgact
gaacttaaagataaggatggaaaagtagtaactactgatgaaaaacaaggttcccgtttt
gatgataatatcttcagccaggaacttgttgtcagtcgtccggctttatggagcccggaa
actcctgttctttatcaggctgtctctaaagtctatgaaggcaatatactgaaggatgaa
tatacaacatctttcggtattcgtactattgaggtcattcccaataagggctttttctta
aatggaaagagaacttcattcaaaggcgtatgcaatcatcatgatctcggccccttggga
ggcgctgtgaatgatgctgctattcgtcgtcagattcgtattttgaaagatatgggttgt
aatgcgattcgtacttctcataatatgcctgctcctgagttaatcagagcttgtgatgag
atgggaatgatggtgatggcggaatcgtttgatgaatggaaggctatgaaggttaagaac
ggctatcgtcatgtttttgacgaatgggcagtaaaggatttgacgaacttgctacgtcat
tatcgtaataatccgagtgtggtgatgtggtgcatcggaaatgaggttcccgaacaatgg
gatggaaataaaggacctaaaatgtcttattttctacaggaactttgtcatcgtgaagat
ccgacacgtcctgtcacacaggggatggatgcgccggatgctgtagtcaataataatatg
gcggcagtaatggatattgcgggatttaattataggccacataaatatcaggagaattat
aaaaaacttcctcaacagatagtcttgggtagtgagactgcttctacggttagttcgcgt
ggagtatataaattccctgttacccggcaatggatgaagaaatatgatgatcaccagtct
tcttcttatgatgtggagtcttgttcatggtccaatctgcctgaggatgattttattcag
catgaggacttaccttattgcataggagagtttgtttggacaggattcgattatctgggt
gaaccgactccctattatacagattggcccagtcattcttcactatttggaattatcgat
ttagcagggctgcccaaagaccgttattatctctatcgtagtcactggaataaagaacag
gaaacacttcacattcttcctcactggaattgggaaggacgagagggagagataactcct
gtctttgtatataccaactatccttcagccgaattattcatcaacggaaagagccaaggg
aaacgtaccaaagacctttccgtaaccattgataacagtgctgactctgtttccatcatg
aacctgaagcgtcagagccgttaccgcctgatgtggatggatacaaaatatgagccgggt
acggtgaaagtcgtggcttatgatgctgacgggaaagctgtagctgaaaaagaactccat
acagccggtaaaccggatcatattgaattggtagccgatcgtaatgtaatcaaagcggat
ggaaaagatttatcttttgtgacagtgcgagtggtagatagagacggtaatctgtgtccg
gatgcctcacatgaaatcagtttcaaagtgaagggagagggtagttaccgtgcaggagct
aatggtaatgcagcttccttggaatctttccagcatccgaagatgaaagtcttcagcggt
atgatgactgctattgtatcttcgacagagcaaccgggcaaaataacccttgaagctacg
ggcaaaggcttgaaaaaaggagccttgatcattgaaagctgtcaggaagctaagaagtaa

DBGET integrated database retrieval system