KEGG   Bacteroides thetaiotaomicron: BT_0527Help
Entry
BT_0527           CDS       T00122                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bth  Bacteroides thetaiotaomicron
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BT_0527 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT_0527 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BT_0527 (trpA)
Enzymes [BR:bth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BT_0527 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651009..651779)
Genome map
AA seq 256 aa AA seqDB search
MNRINQLFNSNKKDILSIYFCAGNPTLDGTVNVIRTLEKHGVSMIEVGIPFSDPMADGIV
IQNAATQALRNGMSLKILFEQLRNIRQEVSIPLVFMGYLNPIMQFGFENFCRKCVECGID
GVIIPDLPFRDYQDHYRIIAERYGIKVIMLITPETSEERVREIDAHTDGFIYMVSSAATT
GAQQDFNEQKRAYFKKIEDMNLRNPLMVGFGISNKATFQAACEHASGAIIGSRFVTLLEE
EKDPEKAILKLKDALK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaatcaactctttaatagcaacaagaaagacatcctttctatttatttt
tgtgcaggtaatcctacccttgatggaacagtcaatgtcatccgtactctcgaaaaacat
ggcgtcagcatgattgaagtcggtattccattcagtgaccctatggcagacggcatcgtt
atccagaatgccgccactcaggcattacgcaacggaatgtcattgaaaatccttttcgaa
caattacgaaacattcgccaggaagtaagtattccattggtatttatgggatacttaaac
cctattatgcagttcggatttgaaaacttctgccgcaaatgcgtggaatgcggaatagac
ggcgttatcatccccgacttgcctttcagagattatcaggatcactaccgtatcattgcc
gaacgttatggaatcaaagtaatcatgctcatcaccccggagaccagcgaagagcgggta
cgtgagatcgatgcacatacagacggattcatctatatggtttcatccgcagcaactaca
ggcgcacaacaagactttaatgaacagaaacgtgcctatttcaaaaagatcgaagatatg
aatctgcgcaacccgctaatggttggtttcggtatctccaacaaagctacttttcaagca
gcttgcgaacatgcttccggagctatcatcggtagccgctttgtcactctgcttgaagaa
gaaaaagatccggaaaaagccattctaaaactgaaagatgcgcttaaatag

DBGET integrated database retrieval system