KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_0529Help
Entry
BT_0529           CDS       T00122                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Pathway
bth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bth01100  Metabolic pathways
bth01110  Biosynthesis of secondary metabolites
bth01130  Biosynthesis of antibiotics
bth01230  Biosynthesis of amino acids
Module
bth_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bth00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BT_0529 (trpC)
Enzymes [BR:bth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BT_0529 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 1071979
NCBI-ProteinID: NP_809442
UniProt: Q8AAD6
Position
complement(652452..653234)
Genome map
AA seq 260 aa AA seqDB search
MKDILSEIIANKRFEVDLQKQAISIEQLQEGINEVPASRSMKRALASSDSGIIAEFKRRS
PSKGWIKQEARPEEIVPSYLAAGASALSILTDEKFFGGSLKDIRTARPLVDVPIIRKDFI
IDEYQLYQAKIVGADAVLLIAAALKQEKCQELAEQAHELGLEVLLEIHSAEELPYINSKI
DMIGINNRNLGTFFTDVENSFRLAGQLPQDAVLVSESGISDPEVVKRLRTAGFRGFLIGE
TFMKTPQPGETLQNFLKAIQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatattatccgaaattatagctaacaaacggtttgaagtcgatttgcaaaag
caggctatttccatcgaacagttgcaggaaggtatcaatgaagttccggcttcccgttct
atgaaacgggcattggcttcttccgattccggtattatagccgaatttaagcgtcgctcg
ccatccaaagggtggatcaaacaggaggcacgtcccgaagaaattgttccgtcatacctt
gcggcaggtgcttccgccctctctattctcactgatgagaagttttttggaggaagtctg
aaagatattcgtacagcacgtcctttggtcgatgtgcccattataagaaaagactttatc
attgatgagtatcagttatatcaggcaaaaattgtcggtgcggatgccgtacttcttatc
gccgccgcactgaaacaggaaaaatgtcaggaactggcagagcaggcgcatgaactggga
ctggaagtattacttgaaatccatagtgcggaagagttaccttatattaatagcaaaatt
gatatgattgggattaataatcgcaatctgggtactttcttcacagatgtagaaaactct
ttccgactggcaggacaacttccacaagatgcggtattagtatcagagagtggcatttcc
gatccggaagtggtaaaacgtcttcggaccgccggattccggggattcctcatcggagag
acatttatgaaaactccgcaaccgggagaaactctgcagaactttctgaaagccatccaa
taa

DBGET integrated database retrieval system